Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.19
PubTator Score 2.25

Knowledge Summary

Patent (1,924)

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03

Gene RIF (2)

PMID Text
22397221 Our results show that the expression rate of some of the T2R taste receptor genes was increased significantly in patients with phantogeusia.
19372376 Includes the study of a polymorphic upstream ORF in this gene, and shows that it functions to reduce protein levels by ~58%.

AA Sequence

MMGLTEGVFLILSGTQFTLGILVNCFIELVNGSSWFKTKRMSLSDFIITTLALLRIILLCIILTDSFLIE      1 - 70
FSPNTHDSGIIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFLWLKWRVSRVMVWMLLGALLL     71 - 140
SCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEYYLIHVLGTLWYLPPLIVSLASYSLLIFSLGRH    141 - 210
TRQMLQNGTSSRDPTTEAHKRAIRIILSFFFLFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGH    211 - 280
SFILILGNSKLKQTFVVMLRCESGHLKPGSKGPIFS                                      281 - 316
//

Text Mined References (19)

PMID Year Title
23568457 2013 Genetic variants associated with disordered eating.
22397221 2012 Patients with phantogeusia show increased expression of T2R taste receptor genes in their tongues.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
19372376 2009 Upstream open reading frames cause widespread reduction of protein expression and are polymorphic among humans.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.
11437385 2001 Identification of coding single-nucleotide polymorphisms in human taste receptor genes involving bitter tasting.
10774719 2000 A plethora of taste receptors.
10766242 2000 A family of candidate taste receptors in human and mouse.
10766221 2000 The good taste of genomics.
10761935 2000 T2Rs function as bitter taste receptors.
10761934 2000 A novel family of mammalian taste receptors.