Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.64
PubTator Score 0.33

Knowledge Summary

Patent (1,580)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

AA Sequence

MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLWVILLHWYSTV      1 - 70
LNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHHLKRKAKSVVLVIVLGSLFFL     71 - 140
VCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIYSLCKHLKKMQ    141 - 210
LHGKGSQDPSTKIHIKALQTVTSFLILLAIYFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILI    211 - 280
WGNKTLKQTFLSVLWQVTCWAKGQNQSTP                                             281 - 309
//

Text Mined References (11)

PMID Year Title