Property Summary

NCBI Gene PubMed Count 17
PubMed Score 11.77
PubTator Score 26.30

Knowledge Summary

Patent (6,707)

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 3.7e-07
Pick disease 1893 2.0e-05
osteosarcoma 7933 1.4e-04
colon cancer 1475 2.3e-03
progressive supranuclear palsy 674 5.6e-03
medulloblastoma, large-cell 6234 7.2e-03
lung cancer 4473 1.6e-02
Breast cancer 3098 2.4e-02
Disease Target Count Z-score Confidence
Pelvic inflammatory disease 21 3.179 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.661 1.4e-04
medulloblastoma, large-cell -1.200 7.2e-03
tuberculosis 1.500 3.7e-07
colon cancer -1.500 2.3e-03
lung cancer 1.100 1.6e-02
Breast cancer 3.200 2.4e-02
Pick disease -1.200 2.0e-05
progressive supranuclear palsy -1.200 5.6e-03

Gene RIF (4)

PMID Text
21942422 TAS2R14 and TAS2R39 were activated by isoflavones and other isoflavonoids.
20930049 These results point to a potential route of action by which components of Hoodia might influence appetite control; the natural taste receptor antagonist was identified for further studies as an appetite suppressant.
20534144 no evidence of statistically significant associations between polymorphisms in the TAS2R14 gene and colon cancer risk
20534144 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVWLIFGSWCVSV      1 - 70
FFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFLYLKWRVKKVVLVLLLVTSVF     71 - 140
LFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRK    141 - 210
KMQHTVKISGDASTKAHRGVKSVITFFLLYAIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVL    211 - 280
ILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS                                     281 - 317
//

Text Mined References (17)

PMID Year Title
21942422 2011 Soy isoflavones and other isoflavonoids activate the human bitter taste receptors hTAS2R14 and hTAS2R39.
20930049 2010 The steroid glycoside H.g.-12 from Hoodia gordonii activates the human bitter receptor TAS2R14 and induces CCK release from HuTu-80 cells.
20534144 2010 A gene-wide investigation on polymorphisms in the taste receptor 2R14 (TAS2R14) and susceptibility to colorectal cancer.
20022913 2010 The molecular receptive ranges of human TAS2R bitter taste receptors.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15744053 2005 Lineage-specific loss of function of bitter taste receptor genes in humans and nonhuman primates.
15496549 2005 Evolution of bitter taste receptors in humans and apes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12581520 2003 Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139982 2002 Receptors for bitter and sweet taste.
11696554 2002 Molecular mechanisms of bitter and sweet taste transduction.
10774719 2000 A plethora of taste receptors.
10766242 2000 A family of candidate taste receptors in human and mouse.
10761935 2000 T2Rs function as bitter taste receptors.
10761934 2000 A novel family of mammalian taste receptors.