Property Summary

NCBI Gene PubMed Count 21
PubMed Score 15.45
PubTator Score 26.30

Knowledge Summary

Patent (6,707)

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 3.7e-07
Pick disease 1894 2.0e-05
osteosarcoma 7950 1.4e-04
colon cancer 1478 2.3e-03
progressive supranuclear palsy 676 5.6e-03
medulloblastoma, large-cell 6241 7.2e-03
lung cancer 4740 1.6e-02
Breast cancer 3578 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pelvic inflammatory disease 21 3.052 1.5
Common cold 67 3.039 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 3.200 2.4e-02
colon cancer -1.500 2.3e-03
lung cancer 1.100 1.6e-02
medulloblastoma, large-cell -1.200 7.2e-03
osteosarcoma -1.661 1.4e-04
Pick disease -1.200 2.0e-05
progressive supranuclear palsy -1.200 5.6e-03
tuberculosis 1.500 3.7e-07

Gene RIF (8)

AA Sequence

MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVWLIFGSWCVSV      1 - 70
FFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFLYLKWRVKKVVLVLLLVTSVF     71 - 140
LFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIVLTSTVFIFIPFTLSLAMFLLLIFSMWKHRK    141 - 210
KMQHTVKISGDASTKAHRGVKSVITFFLLYAIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVL    211 - 280
ILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS                                     281 - 317
//

Text Mined References (21)

PMID Year Title