Property Summary

NCBI Gene PubMed Count 41
PubMed Score 165.37
PubTator Score 75.20

Knowledge Summary

Patent (67,342)

TINX Plot

  Disease (3)

Disease Target Count
Male infertility 170
Disease Target Count P-value
psoriasis 6685 1.2e-14
Disease Target Count Z-score Confidence
Obesity 616 3.627 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.2e-14

Gene RIF (33)

PMID Text
26422579 T1R3 gene expression in the tongue is suppressed by chemotherapy.
26168276 The transcripts of TAS1R3 and UCN2 in peripheral blood cells may be considered potential biomarkers of consumption of sugary and fatty food, respectively, to complement data of food-intake questionnaires.
25924601 TAS1R3 gene rs307355 polymorphism found independent risk factor for dental caries experience by logistic regression & increased risk of caries. Moderate caries (4-7 caries) found to be associated w/TAS1R3 rs307355 heterozygous genotype
25029362 human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3
24214976 A complex molecular mechanism involving changes in the properties of both the orthosteric and non-orthosteric sites of T1R1 underlies the determination of ligand specificity in mammalian T1R1/T1R3.
24068707 effects of artificial sweeteners on adipose tissue may be largely independent of the classical sweet taste receptors, T1R2 and T1R3
23370115 Five amino acid residues in cysteine-rich domain of human T1R3 were involved in the response for sweet-tasting protein, thaumatin
22773945 T1R3 is a receptor responsible for the detection of calcium by taste.
22450161 Overexpressed the human N-terminal domain of T1R3 in E. coli and found that the refolded protein behaves as a dimer; showed that hT1R3-NTD is functional and capable of binding sucralose with an affinity in the millimolar range.
22427794 Data show that that Tas1r1 and Tas1r3 are expressed in murine and human spermatozoa.
21540445 T1R2/T1R3 is involved in glucose-dependent secretion of satiation peptides
21422378 amino acid substitutions (F749S and R757C), located in the transmembrane domain of T1R3, severely impair receptor functions in vitro
21324568 The sweet taste receptors (alpha-gustducin and T1R3) are involved in glucose-stimulated secretion of GLP-1 and PYY.
20302879 Results from mutagenesis and chimeras of the receptor indicated that brazzein interacts with both T1R2 and T1R3 and that the Venus flytrap module of T1R2 is important for brazzein agonism.
19664591 Interactions between the human sweet-sensing T1R2-T1R3 receptor and sweeteners detected by saturation transfer difference NMR spectroscopy.
19587085 Variations in perception of umami taste correlated with variations in the human TAS1R3 gene.
19587085 Observational study of gene-disease association. (HuGE Navigator)
19571223 In our sample of subjects, the frequencies of 2 nsSNPs, C329T in tas1r1 and C2269T in tas1r3, were significantly higher in [glutamate] nontasters than expected, whereas G1114A in tas1r1 was more frequent in tasters.
19559618 Allelic polymorphism within the TAS1R3 promoter is associated with human taste sensitivity to sucrose.
19559618 Observational study of gene-disease association. (HuGE Navigator)
19146926 Taken together, these results suggest that Tas1R1-Tas1R3 receptor variants found in human fungiform papillae might contribute to inter-individual differences of sensitivity to L-glutamate.
19083128 The heteromeric G-protein-coupled receptor T1R2:T1R3 responds to a vast array of chemically diverse natural and artificial sweeteners.
18539481 Expressed in the sweet/umami gustatory pathways in taste receptor cells and trigeminal neural pathways in transgenic mice.
17935609 Some of the amino acid positions crucial for activation of hTAS1R2+hTAS1R3 by neohesperidin dihydrochalcone are involved in the binding of allosteric modulators in other class C GPCRs
17928076 These results show that T1R2 and T1R3 receptors, in addition to their role in taste perception, may also have a role in intrahepatic cholangiocytes.
17499612 Although T1R2-T1R3 is known to have multiple potential ligand-binding sites to receive a wide variety of sweeteners, the present study is apparently the first to identify the ATD of hT1R3 as a new sweetener-binding region.
16633339 water rinses remove the inhibitor from the heteromeric sweetener receptor TAS1R2-TAS1R3, which activates cells and results in the perception of strong sweetness from pure water
15668251 transmembrane domains of human T1R3 bind with lactisole to inhibit sweet taste
15585941 An immunohistochemistry study to determine whether and where T1R3 may be localized in the liver and pancreas.
15353592 findings demonstrate the different functional roles of T1R3 and T1R2 and the presence of multiple ligand binding sites on the sweet taste receptor
15299024 cysteine-rich region of T1R3 has a role in determining responses to intensely sweet proteins
12706725 The mechanism of interaction of the sweet protein monellin with T1R2-T1R3 receptor.
11894099 sequence differences in T1R receptors within and between species (human and mouse) can significantly influence the selectivity and specificity of taste responses

AA Sequence

MLGPAVLGLSLWALLHPGTGAPLCLSQQLRMKGDYVLGGLFPLGEAEEAGLRSRTRPSSPVCTRFSSNGL      1 - 70
LWALAMKMAVEEINNKSDLLPGLRLGYDLFDTCSEPVVAMKPSLMFLAKAGSRDIAAYCNYTQYQPRVLA     71 - 140
VIGPHSSELAMVTGKFFSFFLMPQVSYGASMELLSARETFPSFFRTVPSDRVQLTAAAELLQEFGWNWVA    141 - 210
ALGSDDEYGRQGLSIFSALAAARGICIAHEGLVPLPRADDSRLGKVQDVLHQVNQSSVQVVLLFASVHAA    211 - 280
HALFNYSISSRLSPKVWVASEAWLTSDLVMGLPGMAQMGTVLGFLQRGAQLHEFPQYVKTHLALATDPAF    281 - 350
CSALGEREQGLEEDVVGQRCPQCDCITLQNVSAGLNHHQTFSVYAAVYSVAQALHNTLQCNASGCPAQDP    351 - 420
VKPWQLLENMYNLTFHVGGLPLRFDSSGNVDMEYDLKLWVWQGSVPRLHDVGRFNGSLRTERLKIRWHTS    421 - 490
DNQKPVSRCSRQCQEGQVRRVKGFHSCCYDCVDCEAGSYRQNPDDIACTFCGQDEWSPERSTRCFRRRSR    491 - 560
FLAWGEPAVLLLLLLLSLALGLVLAALGLFVHHRDSPLVQASGGPLACFGLVCLGLVCLSVLLFPGQPSP    561 - 630
ARCLAQQPLSHLPLTGCLSTLFLQAAEIFVESELPLSWADRLSGCLRGPWAWLVVLLAMLVEVALCTWYL    631 - 700
VAFPPEVVTDWHMLPTEALVHCRTRSWVSFGLAHATNATLAFLCFLGTFLVRSQPGCYNRARGLTFAMLA    701 - 770
YFITWVSFVPLLANVQVVLRPAVQMGALLLCVLGILAAFHLPRCYLLMRQPGLNTPEFFLGGGPGDAQGQ    771 - 840
NDGNTGNQGKHE                                                              841 - 852
//

Text Mined References (41)

PMID Year Title
26422579 2016 Effects of chemotherapy on gene expression of lingual taste receptors in patients with head and neck cancer.
26375852 2015 Rubemamine and Rubescenamine, Two Naturally Occurring N-Cinnamoyl Phenethylamines with Umami-Taste-Modulating Properties.
26168276 2015 TAS1R3 and UCN2 Transcript Levels in Blood Cells Are Associated With Sugary and Fatty Food Consumption in Children.
25924601 2015 Association of sweet taste receptor gene polymorphisms with dental caries experience in school children.
25248559 2014 Structure, function, and signaling of taste G-protein-coupled receptors.
25029362 2014 Distinct human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3.
24360415 2014 The taste of D- and L-amino acids: In vitro binding assays with cloned human bitter (TAS2Rs) and sweet (TAS1R2/TAS1R3) receptors.
24214976 2013 Two distinct determinants of ligand specificity in T1R1/T1R3 (the umami taste receptor).
24068707 2013 Artificial sweeteners stimulate adipogenesis and suppress lipolysis independently of sweet taste receptors.
23370115 2013 Five amino acid residues in cysteine-rich domain of human T1R3 were involved in the response for sweet-tasting protein, thaumatin.
22773945 2012 T1R3: a human calcium taste receptor.
22450161 2012 Recombinant expression, in vitro refolding, and biophysical characterization of the N-terminal domain of T1R3 taste receptor.
22427794 2012 Expression of Tas1 taste receptors in mammalian spermatozoa: functional role of Tas1r1 in regulating basal Ca²? and cAMP concentrations in spermatozoa.
21540445 2011 The role of the gut sweet taste receptor in regulating GLP-1, PYY, and CCK release in humans.
21422378 2011 Human genetic polymorphisms in T1R1 and T1R3 taste receptor subunits affect their function.
21324568 2011 The functional involvement of gut-expressed sweet taste receptors in glucose-stimulated secretion of glucagon-like peptide-1 (GLP-1) and peptide YY (PYY).
20302879 2010 Key amino acid residues involved in multi-point binding interactions between brazzein, a sweet protein, and the T1R2-T1R3 human sweet receptor.
19664591 2010 Interactions between the human sweet-sensing T1R2-T1R3 receptor and sweeteners detected by saturation transfer difference NMR spectroscopy.
19587085 2009 Perceptual variation in umami taste and polymorphisms in TAS1R taste receptor genes.
19571223 2009 Nonsynonymous single nucleotide polymorphisms in human tas1r1, tas1r3, and mGluR1 and individual taste sensitivity to glutamate.
19559618 2009 Allelic polymorphism within the TAS1R3 promoter is associated with human taste sensitivity to sucrose.
19146926 2009 Tas1R1-Tas1R3 taste receptor variants in human fungiform papillae.
19083128 2009 The receptor basis of sweet taste in mammals.
18539481 2008 Genetic tracing of the gustatory and trigeminal neural pathways originating from T1R3-expressing taste receptor cells and solitary chemoreceptor cells.
17935609 2007 The binding site for neohesperidin dihydrochalcone at the human sweet taste receptor.
17928076 CCAAT/Enhancer-binding protein beta regulates expression of human T1R3 taste receptor gene in the bile duct carcinoma cell line, HuCCT1.
17499612 2007 Taste-modifying sweet protein, neoculin, is received at human T1R3 amino terminal domain.
17108952 2006 The receptors and cells for mammalian taste.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16633339 2006 A TAS1R receptor-based explanation of sweet 'water-taste'.
15668251 2005 Lactisole interacts with the transmembrane domains of human T1R3 to inhibit sweet taste.
15585941 2004 Expression of the sweet receptor protein, T1R3, in the human liver and pancreas.
15353592 2004 Different functional roles of T1R subunits in the heteromeric taste receptors.
15299024 2004 The cysteine-rich region of T1R3 determines responses to intensely sweet proteins.
12892531 Taste receptor T1R3 is an essential molecule for the cellular recognition of the disaccharide trehalose.
12706725 2003 The mechanism of interaction of sweet proteins with the T1R2-T1R3 receptor: evidence from the solution structure of G16A-MNEI.
11917125 2002 Human receptors for sweet and umami taste.
11894099 2002 An amino-acid taste receptor.
11326277 2001 Tas1r3, encoding a new candidate taste receptor, is allelic to the sweet responsiveness locus Sac.
11319557 2001 A candidate taste receptor gene near a sweet taste locus.