Property Summary

NCBI Gene PubMed Count 29
PubMed Score 92.64
PubTator Score 60.72

Knowledge Summary

Patent (48,942)

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8491 2.8e-11
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Parkinson's disease 364 0.0 1.0
Disease Target Count Z-score Confidence
Dental caries 67 4.264 2.1
diabetes mellitus 1663 3.027 1.5

Gene RIF (21)

PMID Text
26907331 In conclusion, the Val/Val genotype of TAS1R2 was associated with a higher carbohydrate intake and HTG.
26279452 The rs12033832 single nucleotide polymorphism in TAS1R2 is associated with sucrose taste and sugar intake, but the effect differs depending on BMI
25924601 high-risk caries experience (>8 caries) was found to be associated with TAS1R2 rs35874116 homozygous polymorphic genotype.
25029362 human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3
24068707 effects of artificial sweeteners on adipose tissue may be largely independent of the classical sweet taste receptors, T1R2 and T1R3
23349025 Interaction between brazzein and the amino terminal domain of the sweet receptor subunit T1R2 showed a stronger interaction at 7 degrees C than at 37 degrees C.; the low temperature conformation, alters the orientations of 2 loops known to be critical for the sweetness of brazzein, may represent the bound state of brazzei in the complex with the human sweet receptor.
23257979 associated with caries risk
22315413 Genetic ablation of the sweet TR protein T1R2 obliterates fructose-induced insulin release and its potentiating effects on glucose-stimulated insulin secretion in vitro and in vivo.
21540445 T1R2/T1R3 is involved in glucose-dependent secretion of satiation peptides
20943793 Our findings show that a genetic variation in TAS1R2 affects habitual consumption of sugars and may contribute to interindividual differences in changing behaviors in response to dietary counseling.
20943793 Observational study of gene-disease association. (HuGE Navigator)
20858777 significant associations were seen in TAS1R2 for caries risk and/or protection.
20858777 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20302879 Results from mutagenesis and chimeras of the receptor indicated that brazzein interacts with both T1R2 and T1R3 and that the Venus flytrap module of T1R2 is important for brazzein agonism.
20173092 Data show that Positive allosteric modulators of the sweet taste receptor could help reduce the caloric content in food and beverages while maintaining the desired taste.
19664591 Interactions between the human sweet-sensing T1R2-T1R3 receptor and sweeteners detected by saturation transfer difference NMR spectroscopy.
17935609 Some of the amino acid positions crucial for activation of hTAS1R2+hTAS1R3 by neohesperidin dihydrochalcone are involved in the binding of allosteric modulators in other class C GPCRs
16633339 water rinses remove the inhibitor from the heteromeric sweetener receptor TAS1R2-TAS1R3, which activates cells and results in the perception of strong sweetness from pure water
14636554 sweet and umami taste are strictly dependent on T1R-receptors, and show that selective elimination of T1R-subunits differentially abolishes detection and perception of these two taste modalities
12706725 The mechanism of interaction of the sweet protein monellin with the T1R2-T1R3 receptor.

AA Sequence

MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCKEYEVKVIGYN      1 - 70
LMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDNLLPIQEDYSNYISRVVAVIG     71 - 140
PDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPALLRTTPSADHHIEAMVQLMLHFRWNWIIVLV    141 - 210
SSDTYGRDNGQLLGERVARRDICIAFQETLPTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLT    211 - 280
LYHFFNEVLRQNFTGAVWIASESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPL    281 - 350
SRTSQSYTCNQECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQL    351 - 420
LEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTI    421 - 490
PMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETSCFKRQLVFLE    491 - 560
WHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAGGPMCFLMLTLLLVAYMVVPVYVGPPKVSTC    561 - 630
LCRQALFPLCFTICISCIAVRSFQIVCAFKMASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLAT    631 - 700
GLSPTTRTDPDDPKITIVSCNPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYF    701 - 770
TSSVSLCTFMSAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD     771 - 839
//

Text Mined References (29)

PMID Year Title
26907331 2016 Sweet Taste Receptor TAS1R2 Polymorphism (Val191Val) Is Associated with a Higher Carbohydrate Intake and Hypertriglyceridemia among the Population of West Mexico.
26279452 2015 Variation in the TAS1R2 Gene, Sweet Taste Perception and Intake of Sugars.
25924601 2015 Association of sweet taste receptor gene polymorphisms with dental caries experience in school children.
25029362 2014 Distinct human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3.
24068707 2013 Artificial sweeteners stimulate adipogenesis and suppress lipolysis independently of sweet taste receptors.
23568457 2013 Genetic variants associated with disordered eating.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23349025 2013 Temperature-dependent conformational change affecting Tyr11 and sweetness loops of brazzein.
23257979 2013 Association of GLUT2 and TAS1R2 genotypes with risk for dental caries.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
22315413 2012 Sweet taste receptor signaling in beta cells mediates fructose-induced potentiation of glucose-stimulated insulin secretion.
21540445 2011 The role of the gut sweet taste receptor in regulating GLP-1, PYY, and CCK release in humans.
20943793 2010 Genetic variation in TAS1R2 (Ile191Val) is associated with consumption of sugars in overweight and obese individuals in 2 distinct populations.
20858777 2010 Taste genes associated with dental caries.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20302879 2010 Key amino acid residues involved in multi-point binding interactions between brazzein, a sweet protein, and the T1R2-T1R3 human sweet receptor.
20173092 2010 Positive allosteric modulators of the human sweet taste receptor enhance sweet taste.
20070850 2010 Genome-wide association study confirms SNPs in SNCA and the MAPT region as common risk factors for Parkinson disease.
19664591 2010 Interactions between the human sweet-sensing T1R2-T1R3 receptor and sweeteners detected by saturation transfer difference NMR spectroscopy.
17935609 2007 The binding site for neohesperidin dihydrochalcone at the human sweet taste receptor.
17108952 2006 The receptors and cells for mammalian taste.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16633339 2006 A TAS1R receptor-based explanation of sweet 'water-taste'.
14636554 2003 The receptors for mammalian sweet and umami taste.
12856281 2003 Three sweet receptor genes are clustered in human chromosome 1.
12706725 2003 The mechanism of interaction of sweet proteins with the T1R2-T1R3 receptor: evidence from the solution structure of G16A-MNEI.
11917125 2002 Human receptors for sweet and umami taste.
10052456 1999 Putative mammalian taste receptors: a class of taste-specific GPCRs with distinct topographic selectivity.