Property Summary

NCBI Gene PubMed Count 21
PubMed Score 386.14
PubTator Score 42.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.075 5.2e-03
Multiple myeloma 1.420 6.9e-04
glioblastoma 1.200 3.1e-02
juvenile dermatomyositis 1.085 6.0e-09
tuberculosis and treatment for 3 months -1.400 7.0e-07
non-small cell lung cancer 1.206 4.6e-18
lung cancer 1.200 1.8e-02
sonic hedgehog group medulloblastoma 1.300 1.4e-05
ovarian cancer 2.100 1.0e-04
dermatomyositis 1.200 1.2e-02

Gene RIF (4)

PMID Text
25163878 Results show that TARS expression is increased in epithelial ovarian cancer.
23425968 A previously undiscovered function for TARS as an angiogenic, pro-migratory extracellular signaling molecule.
23375620 Our series mainly underscores that interstitial lung disease is frequent in anti-PL7(tars antibody)patients, leading to high morbidity.
22190034 HIV-1 MA is identified to have a physical interaction with threonyl-tRNA synthetase (TARS) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEMYNILKAEHDS      1 - 70
ILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLE     71 - 140
LLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCKKII    141 - 210
KEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKN    211 - 280
SSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGA    281 - 350
YIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF    351 - 420
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVF    421 - 490
GFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCAT    491 - 560
IQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGPTC    561 - 630
DEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERT    631 - 700
ISETIERLQQLKEFRSKQAEEEF                                                   701 - 723
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25163878 2014 Threonyl-tRNA synthetase overexpression correlates with angiogenic markers and progression of human ovarian cancer.
23425968 2013 Secreted Threonyl-tRNA synthetase stimulates endothelial cell migration and angiogenesis.
23375620 2013 Clinical manifestations and outcome of anti-PL7 positive patients with antisynthetase syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17203973 2007 The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
16139798 2005 Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8049265 1994 Presence of role of the 5SrRNA-L5 protein complex (5SRNP) in the threonyl- and histidyl-tRNA synthetase complex in rat liver cytosol.
7626230 1995 Threonyl-tRNA synthetase.
7118437 1982 Kinetic mechanism of threonyl-tRNA synthetase from human placenta.
7118399 1982 Purification and subunit structure studies of human placental threonyl-tRNA synthetase.
3464105 1986 Threonyl-tRNA synthetase gene maps close to leucyl-tRNA synthetase gene on human chromosome 5.
2747635 1989 Isolation of a cDNA clone for human threonyl-tRNA synthetase: amplification of the structural gene in borrelidin-resistant cell lines.
2033077 1991 Nucleotide and deduced amino acid sequence of human threonyl-tRNA synthetase reveals extensive homology to the Escherichia coli and yeast enzymes.