Property Summary

NCBI Gene PubMed Count 487
PubMed Score 1361.60
PubTator Score 1144.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
lung carcinoma 2843 3.1e-11
juvenile dermatomyositis 1187 1.1e-10
osteosarcoma 7950 2.8e-07
dermatomyositis 966 5.6e-04
ovarian cancer 8520 7.9e-04
Multiple myeloma 1332 4.6e-03
astrocytoma 1146 6.3e-03
diabetes mellitus 1728 1.4e-02
acute myeloid leukemia 783 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Alopecia universalis 16 0.0 3.0
Bone cancer 16 0.0 3.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 2.400 4.1e-02
astrocytoma 1.300 6.3e-03
dermatomyositis 1.800 5.6e-04
diabetes mellitus -1.200 1.4e-02
juvenile dermatomyositis 1.048 1.1e-10
lung carcinoma 1.300 3.1e-11
Multiple myeloma 1.238 4.6e-03
osteosarcoma -1.046 1.3e-04
ovarian cancer 1.500 7.9e-04

Protein-protein Interaction (3)

PDB (14)

Gene RIF (480)

AA Sequence

MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN      1 - 70
LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK     71 - 140
TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF    141 - 210
FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP    211 - 280
GGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPS    281 - 350
GNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM          351 - 414
//

Text Mined References (498)

PMID Year Title