Property Summary

NCBI Gene PubMed Count 69
PubMed Score 1074.12
PubTator Score 206.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Microsatellite Instability 12
Disease Target Count Z-score Confidence
Shipyard eye 14 3.628 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.200 9.5e-06
psoriasis 1.400 1.1e-04
atypical teratoid / rhabdoid tumor 1.200 5.7e-06
medulloblastoma, large-cell 1.200 4.9e-03

Protein-protein Interaction (9)

Gene RIF (45)

PMID Text
26582366 SUMOylation of TARBP2 is required for regulating siRNA efficiency.
25668122 HIV-1 Rev-response element RNA acts as an RNA silencing suppressor by competing with TRBP-bound siRNAs.
25668122 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells
25557550 Results show the crystal structure of the interface between microRNA biogenesis proteins Dicer and TRBP. Mutations in this interface prevent recruitment of TRBP to Dicer.
25437560 the role of TRBP and unveils negative feedback regulation of PKR through TRBP phosphorylation.
25043050 identified TARBP2, a double-stranded RNA-binding protein implicated in microRNA processing, as the trans factor that binds the sRSE family and similar structural elements--collectively termed TARBP2-binding structural elements (TBSEs)--in transcripts
24563462 Tarbp2 binding to TRPC4 promotes changes of cytosolic Ca(2+) and, thereby, leads to a dynamic regulation of Dicer activity, essentially at low endogenous Dicer concentrations.
24563327 TARBP2 expression is upregulated in late-stage breast cancer and triple-negative breast cancer and may have a role in poorer disease-free survival and overall survival
24141778 RPL5 binds to the TRBP2 and Ago2 subunits of the RISC and mediates the binding to c-Myc 3'UTR.
24025624 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells
23690119 No frameshift mutations in TARBP2 were identified in a study of 4 cases of upper urinary tract urothelial carcinoma with high microsatellite instability status.
23671264 mRNA expression of TARBP2, but not DICER or DROSHA, is a strong molecular predictor to discriminate between adrenocortical adenomas and carcinomas
23661684 The results show that PACT and TRBP have distinct effects on Dicer-mediated dsRNA processing.
23658827 in vitro binding patterns of human TRBP and PACT to siRNA
23550157 RISC proteins PACT, TRBP, and Dicer, together with PKR, are steroid receptor RNA activator-binding nuclear receptor coregulators that are recruited to the promoters of hormone-regulated genes and regulate the expression of downstream target genes.
23435228 Results show that the region of TRBP that binds immature miRNAs comprises two independent double-stranded RNA-binding domains connected by a 60-residue flexible linker.
23251028 We report an unanticipated dsRNA diffusion behavior of TRBP, which requires two double-stranded RNA binding domains, and its correlation with the role of TRBP in promoting Dicer-induced RNA cleavage.
23006623 TRBP is a key regulator of miRNA processing and targeting in humans.
22999255 Depletion of Dicer and TRBP, proteins involved in miRNA biogenesis, reduced HCV RNA accumulation, mature duplex miR-122 abundance, and miR-122 directed mRNA translation suppression, suggesting roles in miR-122 processing.
22933564 The studies in this review show that TRBP is multifunctional and mediates cross talk between different pathways. Its activities at the molecular level impact the cellular function from normal development to cancer and the response to infections.
22698405 Data suggest that cancer stem cell (CSC) self-renewal and tumor maintenance may depend on deregulation of TARBP2-dependent miRNA expression.
22163034 AGO2, PACT and TRBP are required for the efficient functioning of Dicer in cells
22025453 There was no significant difference in the TARBP2 expression levels between the epithelial skin cancer groups and the healthy controls (P > 0.05).
21526770 results demonstrate for the first time that stress-induced PACT phosphorylation functions to free PACT from the inhibitory interaction with TRBP and also to enhance its interaction with PKR
21080422 The structures dsRNA-bdinding domain 1 and dsRNA binding domain 2 solved by x-ray crystallography and NMR spectroscopy respectively.
20877318 TARBP2 frameshift mutation is associated with hereditary nonpolyposis colorectal cancer.
20732906 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20585341 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20211803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19836333 the three-dimensional structure of human Dicer bound to the protein TRBP at approximately 20 A resolution determined by negative-stain electron microscopy (EM) and single-particle analysis
19820710 The RLC Dicer's N-terminal DExH/D domain, located in a short 'base branch', interacts with TRBP, whereas its C-terminal catalytic domains in the main body are proximal to AGO2.
19422693 Binding of Dicer to TRBPs is critical for RNAi function.
19138993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19047128 Observational study of gene-disease association. (HuGE Navigator)
18948111 RDE-4 preferentially binds long dsRNA, while TRBP binds siRNA with an affinity that is independent of dsRNA length.
18936160 TRBP controls PACT activation of PKR, an activity that is reversed by stress.
18178619 Ago2, Dicer, and TRBP comprise the RISC-loading complex (RLC) and assembles spontaneously in vitro from purified components
17452327 Results indicate that human TRBP and PACT directly interact with each other and associate with Dicer to stimulate the cleavage of double-stranded or short hairpin RNA to siRNA.
17360756 These results suggest that, in the context of HIV replication, TRBP contributes mainly to the enhancement of virus production and that Dicer does not mediate HIV restriction by RNAi.
17360756 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells
16629595 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells
16343534 Data suggest that the cell specifity of HIV-1 expression and replication may be regulated, in part, through the control of TRBP1 expression by NF-Y factors.
15123692 binds to merlin, which inhibits its oncogenic activity; results provide the first clue to the functional interaction between TRBP and merlin and suggest a novel mechanism for the tumor suppressor function of merlin both in vitro and in vivo
14585207 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells
2011739 The binding of HIV-1 TAR and RRE to TRBP displaces small interfering (si) RNAs from binding to TRBP, but RNA interference is restored when HIV-1 Rev or GagPol are coexpressed in cells

AA Sequence

MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGD      1 - 70
TSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLT     71 - 140
RSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSK    141 - 210
KLAKRNAAAKMLLRVHTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLR    211 - 280
SCSLGSLGALGPACCRVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGE    281 - 350
AARRALQYLKIMAGSK                                                          351 - 366
//

Text Mined References (78)

PMID Year Title
26582366 2015 SUMOylation of TARBP2 regulates miRNA/siRNA efficiency.
25668122 2015 HIV-1 RRE RNA acts as an RNA silencing suppressor by competing with TRBP-bound siRNAs.
25608000 2015 Helical defects in microRNA influence protein binding by TAR RNA binding protein.
25557550 2015 Dicer-TRBP complex formation ensures accurate mammalian microRNA biogenesis.
25446899 2014 Cancer exosomes perform cell-independent microRNA biogenesis and promote tumorigenesis.
25437560 2014 Deletion of human tarbp2 reveals cellular microRNA targets and cell-cycle function of TRBP.
25416956 2014 A proteome-scale map of the human interactome network.
25043050 2014 Metastasis-suppressor transcript destabilization through TARBP2 binding of mRNA hairpins.
24563462 2014 Trans-activation response (TAR) RNA-binding protein 2 is a novel modulator of transient receptor potential canonical 4 (TRPC4) protein.
24563327 2014 Up-regulation and worse prognostic marker of cytoplasmic TARBP2 expression in obstinate breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141778 2014 Ribosomal proteins L5 and L11 co-operatively inactivate c-Myc via RNA-induced silencing complex.
23690119 2013 Microsatellite instability and TARBP2 mutation study in upper urinary tract urothelial carcinoma.
23671264 2013 Clinical and functional impact of TARBP2 over-expression in adrenocortical carcinoma.
23661684 2013 Differential roles of human Dicer-binding proteins TRBP and PACT in small RNA processing.
23658827 2013 Distinguishable in vitro binding mode of monomeric TRBP and dimeric PACT with siRNA.
23622242 2013 ADAR1 forms a complex with Dicer to promote microRNA processing and RNA-induced gene silencing.
23550157 2013 RNA-induced silencing complex (RISC) Proteins PACT, TRBP, and Dicer are SRA binding nuclear receptor coregulators.
23435228 2013 The RNA-binding region of human TRBP interacts with microRNA precursors through two independent domains.
23251028 2013 ATP-independent diffusion of double-stranded RNA binding proteins.
23006623 2012 TRBP alters human precursor microRNA processing in vitro.
22999255 2012 Requirements for human Dicer and TRBP in microRNA-122 regulation of HCV translation and RNA abundance.
22933564 2012 The multiple functions of TRBP, at the hub of cell responses to viruses, stress, and cancer.
22698405 2012 A TARBP2-dependent miRNA expression profile underlies cancer stem cell properties and provides candidate therapeutic reagents in Ewing sarcoma.
22163034 2011 The role of Dicer protein partners in the processing of microRNA precursors.
22025453 2012 Expression levels of the microRNA maturing microprocessor complex component DGCR8 and the RNA-induced silencing complex (RISC) components argonaute-1, argonaute-2, PACT, TARBP1, and TARBP2 in epithelial skin cancer.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21526770 2011 Stress-induced phosphorylation of PACT reduces its interaction with TRBP and leads to PKR activation.
21269460 2011 Initial characterization of the human central proteome.
21080422 2011 Structures of the first and second double-stranded RNA-binding domains of human TAR RNA-binding protein.
20877318 2010 Reassessing the TARBP2 mutation rate in hereditary nonpolyposis colorectal cancer.
20732906 2010 Genetic variations in microRNA-related genes are associated with survival and recurrence in patients with renal cell carcinoma.
20585341 2011 Role of primary miRNA polymorphic variants in metastatic colon cancer patients treated with 5-fluorouracil and irinotecan.
20211803 2010 Black carbon exposures, blood pressure, and interactions with single nucleotide polymorphisms in MicroRNA processing genes.
19836333 2009 Structure of the human Dicer-TRBP complex by electron microscopy.
19820710 2009 Structural insights into RNA processing by the human RISC-loading complex.
19804757 2009 Phosphorylation of the human microRNA-generating complex mediates MAPK/Erk signaling.
19716330 2009 Mammalian miRNA RISC recruits CAF1 and PABP to affect PABP-dependent deadenylation.
19422693 2009 Characterization of the TRBP domain required for dicer interaction and function in RNA interference.
19219043 2009 A TARBP2 mutation in human cancer impairs microRNA processing and DICER1 function.
19138993 2008 Genetic variations in microRNA-related genes are novel susceptibility loci for esophageal cancer risk.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
18948111 2008 dsRNA binding properties of RDE-4 and TRBP reflect their distinct roles in RNAi.
18936160 2009 TRBP control of PACT-induced phosphorylation of protein kinase R is reversed by stress.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18421256 Interactions between the double-stranded RNA-binding proteins TRBP and PACT define the Medipal domain that mediates protein-protein interactions.
18178619 2008 In vitro reconstitution of the human RISC-loading complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17531811 2007 RNA helicase A interacts with RISC in human cells and functions in RISC loading.
17507929 2007 MicroRNA silencing through RISC recruitment of eIF6.
17452327 2007 Human TRBP and PACT directly interact with each other and associate with dicer to facilitate the production of small interfering RNA.
17360756 2007 Small interfering RNAs against the TAR RNA binding protein, TRBP, a Dicer cofactor, inhibit human immunodeficiency virus type 1 long terminal repeat expression and viral production.
16424907 2006 The role of PACT in the RNA silencing pathway.
16357216 2005 A human, ATP-independent, RISC assembly machine fueled by pre-miRNA.
16343534 2006 Cell-specific regulation of TRBP1 promoter by NF-Y transcription factor in lymphocytes and astrocytes.
16271387 2005 Human RISC couples microRNA biogenesis and posttranscriptional gene silencing.
16142218 2005 TRBP, a regulator of cellular PKR and HIV-1 virus expression, interacts with Dicer and functions in RNA silencing.
15973356 2005 TRBP recruits the Dicer complex to Ago2 for microRNA processing and gene silencing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15123692 2004 Merlin, a tumor suppressor, interacts with transactivation-responsive RNA-binding protein and inhibits its oncogenic activity.
14585207 2003 Additive activity between the trans-activation response RNA-binding protein, TRBP2, and cyclin T1 on HIV type 1 expression and viral production in murine cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475984 2003 The TAR RNA-binding protein, TRBP, stimulates the expression of TAR-containing RNAs in vitro and in vivo independently of its ability to inhibit the dsRNA-dependent kinase PKR.
12023963 2002 Involvement of TRAF4 in oxidative activation of c-Jun N-terminal kinase.
11641396 2001 Organization of the human tarbp2 gene reveals two promoters that are repressed in an astrocytic cell line.
11443112 2001 Identification and characterization of RRM-containing coactivator activator (CoAA) as TRBP-interacting protein, and its splice variant as a coactivator modulator (CoAM).
11438532 2001 Two dimerization domains in the trans-activation response RNA-binding protein (TRBP) individually reverse the protein kinase R inhibition of HIV-1 long terminal repeat expression.
11228241 2001 Expression of the TAR RNA binding protein in human testis.
11060498 Characterization of TRBP1 and TRBP2. Stable stem-loop structure at the 5' end of TRBP2 mRNA resembles HIV-1 TAR and is not found in its processed pseudogene.
10759868 2000 Analysis of a binding difference between the two dsRNA-binding domains in TRBP reveals the modular function of a KR-helix motif.
10330179 1999 Btf, a novel death-promoting transcriptional repressor that interacts with Bcl-2-related proteins.
8723388 1996 Sequential steps in Tat trans-activation of HIV-1 mediated through cellular DNA, RNA, and protein binding factors.
8455607 1993 Relatedness of an RNA-binding motif in human immunodeficiency virus type 1 TAR RNA-binding protein TRBP to human P1/dsI kinase and Drosophila staufen.
7774957 1995 Genetic mapping in human and mouse of the locus encoding TRBP, a protein that binds the TAR region of the human immunodeficiency virus (HIV-1).
7568151 1995 Double-stranded-RNA-dependent protein kinase and TAR RNA-binding protein form homo- and heterodimers in vivo.
2011739 1991 Characterization of a human TAR RNA-binding protein that activates the HIV-1 LTR.