Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.17
PubTator Score 7.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.300 1.0e-05
group 4 medulloblastoma -1.100 7.1e-04
medulloblastoma, large-cell -1.300 5.7e-05
non primary Sjogren syndrome sicca 1.100 4.3e-02
osteosarcoma -1.200 1.6e-02
tuberculosis 1.200 6.7e-06

 GO Function (1)

Gene RIF (11)

AA Sequence

MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLAKDGAHRGALASSEDRARASLVLKQVPVL      1 - 70
DDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAA     71 - 140
WFMANMQVSGGGPSISLVMKTPRVTKNEALWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASL    141 - 210
DCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGT    211 - 280
YICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGA    281 - 350
SFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLA    351 - 420
LMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS                          421 - 468
//

Text Mined References (18)

PMID Year Title