Property Summary

NCBI Gene PubMed Count 177
PubMed Score 0.00
PubTator Score 295.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.800 9.1e-07
psoriasis 1.600 3.0e-07
cutaneous lupus erythematosus 1.900 3.0e-04
osteosarcoma 1.007 1.2e-02
group 4 medulloblastoma -1.200 5.5e-04
glioblastoma 1.300 5.1e-03
medulloblastoma, large-cell -1.600 4.8e-04
juvenile dermatomyositis 2.577 9.5e-19
primary pancreatic ductal adenocarcinoma 1.461 4.1e-03
tuberculosis 1.400 3.6e-04
colon cancer 1.700 4.8e-02
lung cancer -2.500 1.9e-03
active Crohn's disease 2.197 1.8e-03
ulcerative colitis 2.100 1.2e-08
interstitial cystitis 1.900 7.7e-03
pilocytic astrocytoma 1.300 3.3e-04
primary Sjogren syndrome 2.200 3.1e-05
Endometriosis -1.330 3.0e-02
ovarian cancer 1.200 9.0e-03
pancreatic cancer 1.300 1.3e-02
head and neck cancer and chronic obstruc... 1.100 4.8e-02

Gene RIF (146)

PMID Text
26789246 cryo-electron microscopy structure of human TAP in complex with its inhibitor ICP47, a small protein produced by the herpes simplex virus I
26519531 TAP/TPN complex formation is driven by hydrophobic interactions via leucine zipper-like motifs.
25874709 TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population
25846714 We showed that TAP2 gene has an association with pulmonary tuberculosis in Koreans.
24972609 Our meta-analyses suggested that TAP2-379Ile allele was significantly associated with a 59% increased risk for rheumatoid arthritis
24923865 Studies indicate that ABC transporters associated with antigen processing TAP1/2 (ABCB2/3) is a crucial element of the adaptive immune system.
24501197 Three tapasin binding sites on TAP have been described, two of which are located in the N-terminal domains of TAP1 and TAP2.
24288424 TAP1 AND TAP2 polymorphisms are associated with a reduced risk for developing cervical intraepithelial neoplasia.
24196954 TAP1-TAP2 NBD dimers are not fully stabilized by nucleotides alone, and substrate binding plays a key role in inducing the transition state conformations of the NBD.
24175803 Results suggested an association between TAP2-565 polymorphism and chronic lymphoid leukemia (CLL). TAP2-665 GG genotype might be a risk factor for CLL, chronic myeloblastic leukemia, and multiple myeloma.
23302073 Although lung cancer cells bearing the preprocalcitonin ppCT(16-25) epitope display low levels of TAP, restoration of TAP expression inhibits ppCT antigen presentation.
23189151 the N-terminal region of Snm1B forms a complex containing PSF2 and Mus81, while the C-terminal region is important for PSF2-mediated chromatin association.
22989262 The results suggest that TAP1 and TAP2 gene polymorphisms are associated with not only the susceptibility to hepatitis B virus infection, but also with inflammation progress, advanced fibrogenesis and cancer development.
22911334 Genetic variation in TAP2 was associated with NHL risk overall, and follicular lymphoma risk in particular, and this was independent of other established loci from 6p21.3.
22638925 the N-terminal extension of the TAP2 subunit represents an autonomous domain, which is correctly targeted to and inserted into the endoplasmic reticulum membrane
22065046 Comparison of unpaired 50 primary breast cancer and 33 brain metastases showed lower expression of beta2-microglobulin, transporter associated with antigen processing (TAP) 1, TAP2 and calnexin in the brain lesions.
21843574 The GG genotype at TAP1 position 333 and GA genotype at TAP1 position 637 are positively associated with HIV-TB co-infection and these genotypes may act as a risk factor for developing TB co-infection in HIV-positive individuals.
21796142 Regression analysis revealed that polymorphisms and haplotypes of TAP2 were associated with FEV1 decline by aspirin provocation (P=0.002-0.04) in most of minor homozygotes compared with major homozygotes and AERD development.
21440064 genetic polymorphism is associated with end stage renal disease in patients of North India
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20525414 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20470844 In a southern Spanish population, no differences were observed in the frequencies of the LMP and TAP genotypes between brucellosis patients and controls.
20470844 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20439763 Single cysteine residue within the antigen translocation complex TAP controls the epitope repertoire by stabilizing a receptive conformation.
20204276 The higher frequency of HLA class I antigen and TAP down-regulation in metastases play a role in the clinical course of the disease.
20193774 TAP1-637 and TAP2-379 polymorphisms may have a role in causing genetic tendency for cystic echinococcosis in children in Turkey.
20193774 Observational study of gene-disease association. (HuGE Navigator)
20083708 TAP-impaired HLA class I expression could influence the course of SCC originating in chronic ulcers and could be related to escape from cytotoxic T-lymphocyte surveillance during disease progression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19609238 expression correlates with the cross-presentation capacity/degree of maturation of dendritic cells
19549407 tap1*0101 and tap2*0101 are most common alleles in Chinese Hans.
19549407 Observational study of genotype prevalence. (HuGE Navigator)
19480848 Data show that TAP1-TAP2 SNP haplotype GGGAGG-GGG (TAP1*0301-TAP2*0101) was less common in AS patients than in B27-positive controls.
19480848 Observational study of gene-disease association. (HuGE Navigator)
19404951 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19387463 We report the largest association study of the TAP genes with SLE to date, and the first to test for its separate effect and interaction with the HLA alleles consistently associated with SLE.
19387463 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19297616 Based on a number of experimental data and the homology to the bacterial ABC exporter Sav1866, we constructed a 3D structural model of the core TAP complex and used it to examine the interface between the transmembrane and nucleotide-binding domains
19263211 TAP1 and TAP2 genes polymorphism are not linked to cervical carcinoma, since no association was found between a particular genotype and the disease.
19263211 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19217216 Observational study of gene-disease association. (HuGE Navigator)
19202550 Observational study of gene-disease association. (HuGE Navigator)
19188174 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19148137 Downregulation of TAP2 is associated with acute myeloid leukaemic blasts.
19116923 Observational study of gene-disease association. (HuGE Navigator)
18976687 Observational study of gene-disease association. (HuGE Navigator)
18764808 Observational study of genotype prevalence. (HuGE Navigator)
18694960 These data reveal a novel "feed-forward" mechanism induced by NF-kappaB which ensures that acutely synthesized IRF-1 operates in concert with NF-kappaB to amplify the immunoproteasome and antigen-processing functions of CD40.
18650831 Allele 665 is associated with cervical cancer, but this is strongly influenced by linkage disequilibrium with human leukocyte antigen DQB1.
18433405 Observational study of gene-disease association. (HuGE Navigator)
18385764 TAP1 and TAP2 expression restores both antigen presentation and immunogenicity in A375 melanoma cells and concomitantly increases IL-12 and IFN-gamma production in tumor antigen-specific cytotoxic T lymphocytes.
18309376 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18248301 Observational study of gene-disease association. (HuGE Navigator)
18071882 First report on the role of TAP2 polymorphisms involved in the diverse pathogenesis of dengue virus infection.
18071882 Observational study of gene-disease association. (HuGE Navigator)
17982230 Observational study of gene-disease association. (HuGE Navigator)
17982230 TAP1 but not TAP2 gene polymorphism may be an important factor contributing to the genetic susceptibility in the development of allergic rhinitis in the Korean population
17947644 TAP subunits alternate in the recruitment and loading of a single MHC class I
17703412 Observational study of gene-disease association. (HuGE Navigator)
17581627 Observational study of gene-disease association. (HuGE Navigator)
17581627 study found strong associations of psoriasis with variant alleles of LMP and TAP
17525827 Observational study of gene-disease association. (HuGE Navigator)
17525827 TAP2-651 site is associated with the risk of HBV infection
17491658 Observational study of gene-disease association. (HuGE Navigator)
17245734 Observational study of gene-disease association. (HuGE Navigator)
17245734 results indicate that TAP gene polymorphisms may have had a role in the development of bronchiectasis in our patient group
17192492 Observational study of gene-disease association. (HuGE Navigator)
17192492 Evidence of TAP2 association with type 1 diabetes that is independent of HLA DR-DQ may be based on allele dependence of splicing into isoforms known to have differential peptide selectivities.
17068338 The main active site required for peptide translocation by TAP1-TAP2 complexes resides at the TAP2 nucleotide binding site.
16923719 Observational study of gene-disease association. (HuGE Navigator)
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16721835 Observational study of gene-disease association. (HuGE Navigator)
16721835 These data reveal that the single-site polymorphism of the TAP2 gene at codon 665 may be an indicator for predicting Graves Disease development.
16690408 Observational study of gene-disease association. (HuGE Navigator)
16690408 Two Pemphigus vulgaris (PV) TAP2 risk alleles were identified (TAP2*C and TAP2*D) implying that TAP2 genes are involved in susceptibility to development of PV.
16634865 Observational study of gene-disease association. (HuGE Navigator)
16595160 Observational study of gene-disease association. (HuGE Navigator)
16595160 Several TAP gene polymorphisms were examined and a TAP2 SNP (rs241448) associated with AD found in two independent case-control samples, especially in carriers of the APOE4 allele.
16356928 The data revealed a nonanalogous multipolar bridging of the transporter associated with antigen processing (TAP) transmembrane domains by cytomegalovirus glycoprotein US6
16216677 Observational study of genotype prevalence. (HuGE Navigator)
16215317 Observational study of gene-disease association. (HuGE Navigator)
16215317 The TAP2-2 MspI polymorphism might be associated with calcium stone disease.
16210614 TAP variants lacking TAP2 N-terminal domain build peptide-loading complexes (PLC) that fail to generate stable MHC I-peptide complexes, which correlates with a substantially reduced recruitment of accessory chaperones into the PLC
16191421 Observational study of gene-disease association. (HuGE Navigator)
16191421 allelic frequency of TAP1 and TAP2 and the alleles shared in mother-infant were compared in pre-eclampsia and controls
16174096 N-terminal domains of TAP1 and TAP2 are important for tapasin binding and for optimal peptide loading onto major histocompatibility complex class I molecules.
16112028 Observational study of gene-disease association. (HuGE Navigator)
16112028 Results suggest the possible role of TAP2 gene polymorphism in the genetic susceptibility to systemic sclerosis .
16061226 Transmembrane segment 1 (TM1) of core-TAP2 is critical for its heterodimerization with core-TAP1.
15887980 Observational study of gene-disease association. (HuGE Navigator)
15887980 TAP1-2 gene polymorphisms may, by way of post-transcriptional changes and altered regulation of gene expression, be involve the immune system in the development of primary open-angle glaucoma
15548263 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15488952 interaction of TAP1 and TAP2 and P-glycoprotein with proteasome subunits beta-5 and beta-5i suggest direct targeting of antigenic peptides to the ER via a TAP-proteasome association and a possible role for P-glycoprotein
15385740 Observational study of gene-disease association. (HuGE Navigator)
15343265 Observational study of gene-disease association. (HuGE Navigator)
15343265 Evidence is provided that that the extended haplotype of TAP2 is distinct in pauciarticular and polyarticular rheumatoid factor negative juvenile idiopathic arthritis patients.
15336779 Observational study of gene-disease association. (HuGE Navigator)
15318034 Observational study of gene-disease association. (HuGE Navigator)
14749980 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14749980 The results of this study provide genetic evidence that TAP2 gene codon 565 polymorphism may play a role in rheumatoid arthritis.
14679198 the N-terminal domains of TAP1 and TAP2 are essential for recruitment of tapasin, consequently mediating assembly of the macromolecular peptide-loading complex
14558951 There exists decreased expression of TAP in both childhood ALL and AML, which probably contributes to the escape of leukemia cells from immune surveillance.
12963978 TAP2 gene polymorphism is not linked to renal cell carcinoma
12911283 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12826376 detected the presence of 17 nucleotide sequence variations in the entire coding region of TAP2 in an indigenous Zimbabwean population (Shona ethnic group)
12786999 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12786999 this allele is preferentially associated with the large conserved haplotype HLA DQA1*0501-DQB1*0201-DRB1*0301 and restricted to populations of African origin
12786997 Observational study of gene-disease association. (HuGE Navigator)
12777979 Expression of TAP2 is not identical to TAP1 in primary melanoma lesions.
12777379 peptide binding induces a conformation that triggers ATP hydrolysis in both subunits of the TAP complex within the catalytic cycle
12729048 Observational study of gene-disease association. (HuGE Navigator)
12729048 TAP2*Bky2 or its haplotype with DRB1*08032 may be involved in SS-A/Ro antibody production not only in SS but also SLE, indicating that TAP2*Bky2 may be a susceptible gene not only to the disease of SS but also to the SS-A/Ro autoantibody production.
12717621 Observational study of gene-disease association. (HuGE Navigator)
12687213 Observational study of gene-disease association. (HuGE Navigator)
12682044 The binding sites contributing to the substrate specificity and subcellular localization of this protein are identified.
12648282 Observational study of gene-disease association. (HuGE Navigator)
12648225 Observational study of gene-disease association. (HuGE Navigator)
12645939 Mutations in the ABC-transporter signature motifs of TAP2 inhibit the translocation of peptide without affecting binding of either peptide or ATP by TAP. This motif is required after peptide binding to facilitate peptide translocation by TAP.
12634240 Observational study of gene-disease association. (HuGE Navigator)
12594855 A major role for tapasin as a stabilizer of the TAP peptide transporter and consequences for MHC class I expression
12507827 Observational study of gene-disease association. (HuGE Navigator)
12505156 cysteine-less TAP1 and TAP2 are functional with respect to adenosine triphosphate (ATP)-dependent peptide transport
12485523 Observational study of gene-disease association. (HuGE Navigator)
12234057 IFN-gamma and LPS upregulated the expression of TAP1 and TAP2 in primary human macrophages
12225333 Observational study of gene-disease association. (HuGE Navigator)
12047361 Observational study of gene-disease association. (HuGE Navigator)
12047361 examination of TAP1 and TAP2 gene polymorphisms in rheumatoid arthritis patients revealed an association between a particular amino acid residue, namely Thr565 in the TAP2 gene, and rheumatoid arthritis
12026214 Observational study of gene-disease association. (HuGE Navigator)
12026214 There was a significant difference in the frequencies at position 665 of TAP 2 gene. TAP genes might have modifying effects on the cystic fibrosis phenotype.
12018331 Observational study of gene-disease association. (HuGE Navigator)
11960305 Observational study of genotype prevalence. (HuGE Navigator)
11916171 Observational study of gene-disease association. (HuGE Navigator)
11916171 Analysis of TAP2 polymorphisms in Finnish individuals with type I diabetes.
11775239 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11774612 Regulation of transporters associated with antigen processing (TAPs) by nucleotide binding to, and hydrolysis by, Walker consensus sequences
11737038 Observational study of gene-disease association. (HuGE Navigator)
11494532 Observational study of gene-environment interaction. (HuGE Navigator)
11294565 Observational study of genotype prevalence. (HuGE Navigator)
11229461 Observational study of gene-disease association. (HuGE Navigator)
11096258 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLC      1 - 70
LATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWR     71 - 140
LLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCR    141 - 210
GGCFTYTMSRINLRIREQLFSSLLRQDLGFFQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVG    211 - 280
LYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLREIQDAVARAGQVVREAVGGLQTVRSFGAEEH    281 - 350
EVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQDGELTQGSLLSFMIYQESVG    351 - 420
SYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLT    421 - 490
FTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSV    491 - 560
RNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLIL    561 - 630
DEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL                  631 - 686
//

Text Mined References (180)

PMID Year Title
26789246 2016 A mechanism of viral immune evasion revealed by cryo-EM analysis of the TAP transporter.
26519531 2015 Hydrophobic Interactions Are Key To Drive the Association of Tapasin with Peptide Transporter Subunit TAP2.
25874709 2015 Association of polymorphisms in HLA antigen presentation-related genes with the outcomes of HCV infection.
25846714 2015 Association of TAP1 and TAP2 genes with susceptibility to pulmonary tuberculosis in Koreans.
24972609 2014 Significant association between TAP2 polymorphisms and rheumatoid arthritis: a meta-analysis.
24923865 2015 ABC transporters in adaptive immunity.
24501197 2014 Three tapasin docking sites in TAP cooperate to facilitate transporter stabilization and heterodimerization.
24288424 2013 Association of TAP gene polymorphisms and risk of cervical intraepithelial neoplasia.
24196954 2013 Analyses of conformational states of the transporter associated with antigen processing (TAP) protein in a native cellular membrane environment.
24175803 2013 Association of TAP1 and TAP2 gene polymorphisms with hematological malignancies.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23349640 2013 Susceptibility loci associated with specific and shared subtypes of lymphoid malignancies.
23302073 2013 TAP expression level in tumor cells defines the nature and processing of MHC class I peptides for recognition by tumor-specific cytotoxic T lymphocytes.
23189151 2012 Snm1B interacts with PSF2.
23028341 2012 Genome-wide association study for serum complement C3 and C4 levels in healthy Chinese subjects.
22989262 2012 Association of TAP1 and TAP2 polymorphisms with the outcome of persistent HBV infection in a northeast Han Chinese population.
22911334 2012 A two-stage evaluation of genetic variation in immune and inflammation genes with risk of non-Hodgkin lymphoma identifies new susceptibility locus in 6p21.3 region.
22638925 2012 Direct evidence that the N-terminal extensions of the TAP complex act as autonomous interaction scaffolds for the assembly of the MHC I peptide-loading complex.
22065046 2012 Expression of antigen processing and presenting molecules in brain metastasis of breast cancer.
21843574 2011 Association of TAP 1 and 2 gene polymorphisms with human immunodeficiency virus-tuberculosis co-infection.
21796142 2011 Genetic association analysis of TAP1 and TAP2 polymorphisms with aspirin exacerbated respiratory disease and its FEV1 decline.
21440064 2011 Genetic polymorphisms in MHC-encoded antigen processing gene TAP2: a case-control study in end-stage renal disease patients of North India.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20525414 2011 Genetic variation in the LMP/TAP gene and outcomes of hepatitis B virus infection in the Chinese population.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20470844 2010 No association of TAP and LMP genetic polymorphism in human brucellosis and its complications.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20439763 2010 Single residue within the antigen translocation complex TAP controls the epitope repertoire by stabilizing a receptive conformation.
20204276 2010 HLA class I antigen and transporter associated with antigen processing downregulation in metastatic lesions of head and neck squamous cell carcinoma as a marker of poor prognosis.
20193774 2010 TAP1 and TAP2 gene polymorphisms in childhood cystic echinococcosis.
20083708 2010 A novel mutation in the TAP2 gene in bare lymphocyte syndrome: association with metastatic cutaneous squamous cell carcinoma.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19609238 2009 Maturation pathways of dendritic cells determine TAP1 and TAP2 levels and cross-presenting function.
19549407 2009 [Distribution of tap1 and tap2 loci allelic and genotypic frequencies in Chinese Hans].
19480848 2009 TAP1 and TAP2 polymorphisms associated with ankylosing spondylitis in genetically homogenous Chinese Han population.
19404951 2009 Association of a specific ERAP1/ARTS1 haplotype with disease susceptibility in ankylosing spondylitis.
19387463 2009 Variation in the ATP-binding cassette transporter 2 gene is a separate risk factor for systemic lupus erythematosus within the MHC.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19297616 2009 Structural arrangement of the transmission interface in the antigen ABC transport complex TAP.
19263211 2009 No association of TAP1 and TAP2 genes polymorphism with risk of cervical cancer in north Indian population.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19217216 2009 Transporter associated with antigen processing and the chaperone tapasin: are non-classical HLA genes keys to the pathogenesis of schizophrenia?
19202550 2009 Single nucleotide polymorphisms in antigen processing machinery component ERAP1 significantly associate with clinical outcome in cervical carcinoma.
19201886 2009 Specific targeting of the EBV lytic phase protein BNLF2a to the transporter associated with antigen processing results in impairment of HLA class I-restricted antigen presentation.
19188174 2009 Genetic variants in TAP are associated with high-grade cervical neoplasia.
19148137 2009 In situ analysis of the antigen-processing machinery in acute myeloid leukaemic blasts by tissue microarray.
19116923 2009 Genetic association of the major histocompatibility complex with rheumatoid arthritis implicates two non-DRB1 loci.
18976687 2008 Genetic variants in the HLA-G region are associated with Kawasaki disease.
18802093 2008 The varicellovirus UL49.5 protein blocks the transporter associated with antigen processing (TAP) by inhibiting essential conformational transitions in the 6+6 transmembrane TAP core complex.
18764808 2008 Determination of TAP1 and TAP2 polymorphism in the Chinese Han population by real-time TaqMan polymerase chain reaction.
18694960 2008 CD40 induces antigen transporter and immunoproteasome gene expression in carcinomas via the coordinated action of NF-kappaB and of NF-kappaB-mediated de novo synthesis of IRF-1.
18650831 2008 MHC loci affecting cervical cancer risk: distinguishing the effects of HLA-DQB1 and non-HLA genes TNF, LTA, TAP1 and TAP2.
18433405 2008 Polymorphisms of the TAP 1 and 2 gene may influence clinical outcome of primary dengue viral infection.
18385764 2008 Restoration of the expression of transports associated with antigen processing in human malignant melanoma increases tumor-specific immunity.
18309376 Several regions in the major histocompatibility complex confer risk for anti-CCP-antibody positive rheumatoid arthritis, independent of the DRB1 locus.
18248301 2008 Variation in HLA class I antigen-processing genes and susceptibility to human papillomavirus type 16-associated cervical cancer.
18071882 2008 Significance of transporter associated with antigen processing 2 (TAP2) gene polymorphisms in susceptibility to dengue viral infection.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17982230 2007 TAP1 and TAP2 gene polymorphisms in Korean patients with allergic rhinitis.
17947644 2007 Molecular architecture of the TAP-associated MHC class I peptide-loading complex.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17581627 2007 Strong associations of psoriasis with antigen processing LMP and transport genes TAP differ by gender and phenotype.
17525827 2007 Genetic polymorphisms of LMP/TAP gene and hepatitis B virus infection risk in the Chinese population.
17491658 2005 Genetic susceptibility to type 1 diabetes in the intracellular pathway of antigen processing - a subject review and cross-study comparison.
17245734 2007 The role of TAP1 and TAP2 gene polymorphism in idiopathic bronchiectasis in children.
17192492 2007 Genetic control of alternative splicing in the TAP2 gene: possible implication in the genetics of type 1 diabetes.
17068338 2006 Catalytic site modifications of TAP1 and TAP2 and their functional consequences.
17055437 2006 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing.
16923719 2006 No difference in polymorphism frequency in a Turkish population with allergic rhinitis.
16886895 2006 Genetic predisposition of responsiveness to therapy for chronic hepatitis C.
16828748 2006 The first N-terminal transmembrane helix of each subunit of the antigenic peptide transporter TAP is essential for independent tapasin binding.
16721835 2006 Association between the TAP2 gene codon 665 polymorphism and Graves' disease.
16690408 2005 Pemphigus vulgaris is associated with the transporter associated with antigen processing (TAP) system.
16634865 2006 Analysis of IL1B, TAP1, TAP2 and IKBL polymorphisms on susceptibility to tuberculosis.
16595160 2007 A TAP2 genotype associated with Alzheimer's disease in APOE4 carriers.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
16356928 2006 Physical and functional interactions of the cytomegalovirus US6 glycoprotein with the transporter associated with antigen processing.
16216677 2005 TAP1 and TAP2 polymorphisms and their linkage disequilibrium with HLA-DR, -DP, and -DQ in an eastern Andalusian population.
16215317 2005 TAP 2 gene Msp-I polymorphism might be associated with calcium oxalate stone disease.
16210614 2005 Critical role for the tapasin-docking site of TAP2 in the functional integrity of the MHC class I-peptide-loading complex.
16191421 2005 Analysis of TAP1 and TAP2 polymorphism of mother-infant in Chinese patients with pre-eclampsia.
16174096 2005 Identification of domain boundaries within the N-termini of TAP1 and TAP2 and their importance in tapasin binding and tapasin-mediated increase in peptide loading of MHC class I.
16112028 2005 Association of TAP1 and TAP2 gene polymorphisms with systemic sclerosis in Korean patients.
16061226 2005 Exploring the minimal functional unit of the transporter associated with antigen processing.
15887980 2004 Transporter associated with antigen processing gene 1 codon 333 and codon 637 polymorphisms are associated with primary open-angle glaucoma.
15793001 2005 Varicelloviruses avoid T cell recognition by UL49.5-mediated inactivation of the transporter associated with antigen processing.
15548263 2004 Lack of a strong association between HLA class II, tumour necrosis factor and transporter associated with antigen processing gene polymorphisms and virological response to alpha-interferon treatment in patients with chronic hepatitis C.
15518576 2004 Detection of TAP family dimerizations by an in vivo assay in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488952 2005 Cytoplasmic domains of the transporter associated with antigen processing and P-glycoprotein interact with subunits of the proteasome.
15385740 2004 Lack of associations between HLA class II alleles and resistance to HIV-1 infection among white, non-Hispanic homosexual men.
15343265 2004 HLA-DRB1, TAP2/TAP1, and HLA-DPB1 haplotypes in Finnish juvenile idiopathic arthritis: more complexity within the MHC.
15336779 2004 Is TAP2*0102 allele involved in insulin-dependent diabetes mellitus (type 1) protection?
15318034 2004 No association of TAP2 polymorphisms in Korean patients with schizophrenia.
14749980 2004 Association of TAP2 gene polymorphisms in Chinese patients with rheumatoid arthritis.
14679198 2004 Functional dissection of the transmembrane domains of the transporter associated with antigen processing (TAP).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14558951 2003 [Expression of transporter associated with antigen processing (TAP) in childhood acute leukemia and its clinical significance].
12963978 2003 Analysis of the structural integrity of the TAP2 gene in renal cell carcinoma.
12911283 2003 Association of transporter associated with antigen processing genes with Behçet's disease in Japanese.
12826376 2003 New transporter associated with antigen processing (TAP-2) polymorphisms in the Shona people of Zimbabwe.
12786999 2003 Comparison of TAP2 frequencies in type 1 diabetes patients and healthy controls from three ethnic groups indicates an African origin for the TAP2 G allele.
12786997 2003 Lack of association between transporter associated with antigen processing (TAP) and HLA-DM gene polymorphisms and antibody levels following measles vaccination.
12777979 2003 Association of TAP1 downregulation in human primary melanoma lesions with lack of spontaneous regression.
12777379 2003 Peptides induce ATP hydrolysis at both subunits of the transporter associated with antigen processing.
12729048 2003 Association of the TAP2*Bky2 allele with presence of SS-A/Ro and other autoantibodies in Japanese patients with systemic lupus erythematosus.
12717621 2003 Association of polymorphisms in human leukocyte antigen class I and transporter associated with antigen processing genes with resistance to human immunodeficiency virus type 1 infection.
12687213 2001 Polymorphism of Immune Response Genes as a Factor for Predisposition to Development of Diseases.
12682044 2003 Identification of domains participating in the substrate specificity and subcellular localization of the multidrug resistance proteins MRP1 and MRP2.
12648282 2003 Polymorphisms of the TAP1 and TAP2 genes in human alveolar echinococcosis.
12648225 2003 Association of TAP and HLA-DM genes with psoriasis in Koreans.
12645939 2003 The ABC-transporter signature motif is required for peptide translocation but not peptide binding by TAP.
12634240 2003 TAP1 and TAP2 polymorphisms analysis in northwestern Colombian patients with systemic lupus erythematosus.
12594855 2003 A major role for tapasin as a stabilizer of the TAP peptide transporter and consequences for MHC class I expression.
12507827 2003 Polymorphisms of human TAP2 detected by denaturing gradient gel electrophoresis.
12505156 2003 Functional cysteine-less subunits of the transporter associated with antigen processing (TAP1 and TAP2) by de novo gene assembly.
12485523 2002 [Antigen transporter gene polymorphism and predisposition to Graves disease: a preliminary analysis].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234057 2002 Differential regulation of the expression of transporters associated with antigen processing, TAP1 and TAP2, by cytokines and lipopolysaccharide in primary human macrophages.
12225333 2002 A single nucleotide polymorphism of the low molecular mass polypeptide 7 gene influences the interferon response in patients with chronic hepatitis C.
12213826 2002 Tapasin interacts with the membrane-spanning domains of both TAP subunits and enhances the structural stability of TAP1 x TAP2 Complexes.
12202157 2002 Assembly and cell surface expression of TAP-independent, chloroquine-sensitive and interferon-gamma-inducible class I MHC complexes in transformed fibroblast cell lines are regulated by tapasin.
12047747 2002 Interactions formed by individually expressed TAP1 and TAP2 polypeptide subunits.
12047361 2002 TAP1 and TAP2 gene polymorphism in rheumatoid arthritis in a population in eastern France.
12026214 Analysis of the modifying effects of TAP 1/2 genes on cystic fibrosis phenotype.
12018331 2002 Lack of association between gene polymorphism of transporters associated with antigen processing and allergic rhinitis in a Japanese population.
11960305 2002 Distribution of TAP gene polymorphisms and extended MHC haplotypes in Mexican Mestizos and in Seri Indians from northwest Mexico.
11916171 2002 Analysis of TAP2 polymorphisms in Finnish individuals with type I diabetes.
11775239 2000 Polymorphisms of TAP, LMP and HLA-DM genes in the Chinese.
11774612 2001 Regulation of transporters associated with antigen processing (TAPs) by nucleotide binding to, and hydrolysis by, Walker consensus sequences.
11737038 2001 Distribution of HLA-A, B alleles and polymorphisms of TAP and LMP genes in Korean patients with atopic dermatitis.
11532960 2001 Structure of the ABC ATPase domain of human TAP1, the transporter associated with antigen processing.
11494532 2001 [Involvement of TAP2 and LMP7 gene polymorphisms in HCV infection].
11381133 2001 Distinct functions and cooperative interaction of the subunits of the transporter associated with antigen processing (TAP).
11294565 2001 Genotyping TAP2 variants in North American Caucasians, Brazilians, and Africans.
11229461 2001 HLA haplotype analysis in Finnish patients with rheumatoid arthritis.
11157746 2001 The human cytomegalovirus gene product US6 inhibits ATP binding by TAP.
11133832 2001 Identification of sequences in the human peptide transporter subunit TAP1 required for transporter associated with antigen processing (TAP) function.
11096258 2000 TAP1 and TAP2 polymorphism in Spanish patients with ankylosing spondylitis.
10835348 2000 ABC-me: a novel mitochondrial transporter induced by GATA-1 during erythroid differentiation.
10605026 2000 HLA-F is a predominantly empty, intracellular, TAP-associated MHC class Ib protein with a restricted expression pattern.
10560675 1999 Association of a syndrome resembling Wegener's granulomatosis with low surface expression of HLA class-I molecules.
10508608 1999 Nucleotide binding by TAP mediates association with peptide and release of assembled MHC class I molecules.
10227971 1999 Cutting edge: adenovirus E19 has two mechanisms for affecting class I MHC expression.
9916708 1999 Novel splicing of the human MHC-encoded peptide transporter confers unique properties.
9672156 1998 New TAP2 polymorphisms in Africans.
9551969 1998 Reduced cell surface expression of HLA-C molecules correlates with restricted peptide binding and stable TAP interaction.
9324024 1997 Association of a new allele of the TAP2 gene, TAP2*Bky2 (Val577), with susceptibility to Sjögren's syndrome.
9175839 1997 The ER-luminal domain of the HCMV glycoprotein US6 inhibits peptide translocation by TAP.
9103419 1997 Antigen processing and presentation by human trophoblast-derived cell lines.
9002450 1997 A new human transporter associated with antigen processing alleles encodes a large C-terminal protein domain.
8955196 1996 Multiple regions of the transporter associated with antigen processing (TAP) contribute to its peptide binding site.
8805302 1996 Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP.
8773329 1996 A novel TAP 2 gene RFLP observed in a Japanese.
8670825 1996 Molecular mechanism and species specificity of TAP inhibition by herpes simplex virus ICP47.
8568858 1996 Evolutionary dynamics of non-coding sequences within the class II region of the human MHC.
8496691 1993 Presentation of numerous viral peptides to mouse major histocompatibility complex (MHC) class I-restricted T lymphocytes is mediated by the human MHC-encoded transporter or by a hybrid mouse-human transporter.
8458375 1993 The major histocompatibility complex-encoded proteasome component LMP7: alternative first exons and post-translational processing.
8453065 1993 The transporters associated with antigen presentation.
8428770 1993 Alleles and haplotypes of the MHC-encoded ABC transporters TAP1 and TAP2.
8162639 Polymorphisms in the TAP2 gene and their association with rheumatoid arthritis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7835969 1994 Expression of HLA class II-associated peptide transporter and proteasome genes in human placentas and trophoblast cell lines.
7792761 1995 Novel human TAP2*103 allele shows further polymorphism in the ATP-binding domain.
7760936 1995 A viral inhibitor of peptide transporters for antigen presentation.
7673167 1995 Assembly, intracellular localization, and nucleotide binding properties of the human peptide transporters TAP1 and TAP2 expressed by recombinant vaccinia viruses.
7538543 1995 An epitope-selective, transporter associated with antigen presentation (TAP)-1/2-independent pathway and a more general TAP-1/2-dependent antigen-processing pathway allow recognition of the HIV-1 envelope glycoprotein by CD8+ CTL.
7517574 1994 Homozygous human TAP peptide transporter mutation in HLA class I deficiency.
2259383 1990 Sequences encoded in the class II region of the MHC related to the 'ABC' superfamily of transporters.
1946428 1991 Two putative subunits of a peptide pump encoded in the human major histocompatibility complex class II region.
1741401 1992 Polymorphism in a second ABC transporter gene located within the class II region of the human major histocompatibility complex.
1570316 1992 Allelic variants of the human putative peptide transporter involved in antigen processing.
1538751 1992 Assembly and function of the two ABC transporter proteins encoded in the human major histocompatibility complex.
1529427 1992 Nomenclature for factors of the HLA system, 1991. WHO Nomenclature Committee for factors of the HLA system.
1453454 1992 DNA sequence analysis of 66 kb of the human MHC class II region encoding a cluster of genes for antigen processing.