Property Summary

NCBI Gene PubMed Count 33
PubMed Score 33.41
PubTator Score 19.66

Knowledge Summary

Patent (5,037)

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 2.200 3.4e-02
oligodendroglioma 1.200 1.9e-02
osteosarcoma 2.868 1.2e-06
medulloblastoma, large-cell 1.300 4.3e-05
acute quadriplegic myopathy 1.014 2.8e-04
primary pancreatic ductal adenocarcinoma 1.490 1.3e-02
intraductal papillary-mucinous adenoma (... 1.200 1.5e-02
intraductal papillary-mucinous carcinoma... 1.100 3.1e-02
group 4 medulloblastoma 1.700 4.1e-03
acute myeloid leukemia 1.500 2.5e-02
Pick disease 2.200 3.3e-06
ovarian cancer -2.200 3.5e-05
pancreatic cancer 1.700 8.5e-04

Protein-protein Interaction (5)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (12)

PMID Text
24898139 The TAO1 kinase is required for ensuring the normal congression of chromosomes. Depletion of TAO1 reduces the density of growing interphase and mitotic microtubules in human cells, showing TAO1's role in controlling microtubule dynamics.
23585562 tau is a good substrate for PSK1 and PSK2 phosphorylation with mass spectrometric analysis of phosphorylated tau revealing more than 40 tau residues as targets of these kinases.
22075148 Human TAO1 can phosphorylate and activate human MST2
20162290 Data do not support the notion that Tao1 is a component of the spindle checkpoint.
19904549 the apparent role of the Tao1 kinase in spindle checkpoing signaling might in reality reflect an off-target effect produced by particular Tao1-directed siRNA oligonucleotides on Mad2
19110211 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18216281 Spred1-MARKK binding has no effect on the activity of MARKK; therefore, it does not change microtubule (MT) stability.
18187620 Knockdown of TAO kinase 1 (TAOK1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17900936 It is concluded that human TAO kinase 1 induces apoptosis in SH-SY5Y cells and the kinase domain is essential, but its catalytic activity seems to be dispensable in this case.
17417629 Dual functions of TAO1 in regulating microtubule dynamics and checkpoint signalling may help to coordinate the establishment and monitoring of correct congression of chromosomes, thereby protecting genomic stability in human cells.
17396146 TAO kinases are regulators of p38-mediated responses to DNA damage and are intermediates in the activation of p38 by ATM.
16407310 Prostate-derived sterile 20-like kinase 2 (PSK2) regulates apoptotic morphology via C-Jun N-terminal kinase and Rho kinase-1

AA Sequence

MPSTNRAGSLKDPEIAELFFKEDPEKLFTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKW      1 - 70
QDIIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQGLA     71 - 140
YLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWS    141 - 210
LGITCIELAERKPPLFNMNAMSALYHIAQNESPTLQSNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIF    211 - 280
VLRERPETVLIDLIQRTKDAVRELDNLQYRKMKKLLFQEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGS    281 - 350
NQSIPSMSISASSQSSSVNSLPDVSDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQ    351 - 420
SPPQVSRHKSHYRNREHFATIRTASLVTRQMQEHEQDSELREQMSGYKRMRRQHQKQLMTLENKLKAEMD    421 - 490
EHRLRLDKDLETQRNNFAAEMEKLIKKHQAAMEKEAKVMSNEEKKFQQHIQAQQKKELNSFLESQKREYK    491 - 560
LRKEQLKEELNENQSTPKKEKQEWLSKQKENIQHFQAEEEANLLRRQRQYLELECRRFKRRMLLGRHNLE    561 - 630
QDLVREELNKRQTQKDLEHAMLLRQHESMQELEFRHLNTIQKMRCELIRLQHQTELTNQLEYNKRREREL    631 - 700
RRKHVMEVRQQPKSLKSKELQIKKQFQDTCKIQTRQYKALRNHLLETTPKSEHKAVLKRLKEEQTRKLAI    701 - 770
LAEQYDHSINEMLSTQALRLDEAQEAECQVLKMQLQQELELLNAYQSKIKMQAEAQHDRELRELEQRVSL    771 - 840
RRALLEQKIEEEMLALQNERTERIRSLLERQAREIEAFDSESMRLGFSNMVLSNLSPEAFSHSYPGASGW    841 - 910
SHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQ    911 - 980
GMSRSTSVTSQISNGSHMSYT                                                     981 - 1001
//

Text Mined References (49)

PMID Year Title
24898139 2014 TAO1 kinase maintains chromosomal stability by facilitating proper congression of chromosomes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23585562 2013 Prostate-derived sterile 20-like kinases (PSKs/TAOKs) phosphorylate tau protein and are activated in tangle-bearing neurons in Alzheimer disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22075148 2011 The sterile 20-like kinase Tao-1 controls tissue growth by regulating the Salvador-Warts-Hippo pathway.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20949042 2010 Signal transduction protein array analysis links LRRK2 to Ste20 kinases and PKC zeta that modulate neuronal plasticity.
20162290 2010 Re-evaluating the role of Tao1 in the spindle checkpoint.
19904549 2010 Re-examination of siRNA specificity questions role of PICH and Tao1 in the spindle checkpoint and identifies Mad2 as a sensitive target for small RNAs.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19110211 2009 A genome-wide association study identifies three loci associated with mean platelet volume.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18216281 2008 Spred1 and TESK1--two new interaction partners of the kinase MARKK/TAO1 that link the microtubule and actin cytoskeleton.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17900936 2008 Human TAO kinase 1 induces apoptosis in SH-SY5Y cells.
17417629 2007 A functional genomic screen identifies a role for TAO1 kinase in spindle-checkpoint signalling.
17396146 2007 TAO kinases mediate activation of p38 in response to DNA damage.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16893890 2006 Osmotic stress activates the TAK1-JNK pathway while blocking TAK1-mediated NF-kappaB activation: TAO2 regulates TAK1 pathways.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16407310 2006 Prostate-derived sterile 20-like kinase 2 (PSK2) regulates apoptotic morphology via C-Jun N-terminal kinase and Rho kinase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14517247 2003 MARKK, a Ste20-like kinase, activates the polarity-inducing kinase MARK/PAR-1.
13679851 2003 Comparative studies of a new subfamily of human Ste20-like kinases: homodimerization, subcellular localization, and selective activation of MKK3 and p38.
12665513 2003 TAO (thousand-and-one amino acid) protein kinases mediate signaling from carbachol to p38 mitogen-activated protein kinase and ternary complex factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11733138 2001 kin-18, a C. elegans protein kinase involved in feeding.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10497253 1999 Isolation of the protein kinase TAO2 and identification of its mitogen-activated protein kinase/extracellular signal-regulated kinase kinase binding domain.
9786855 1998 Isolation of TAO1, a protein kinase that activates MEKs in stress-activated protein kinase cascades.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.