Property Summary

NCBI Gene PubMed Count 60
PubMed Score 67.51
PubTator Score 1574.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.013 4.0e-04
adult high grade glioma 1.800 1.1e-03
atypical teratoid / rhabdoid tumor 1.600 4.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.001 5.6e-03
Breast cancer -1.500 2.2e-25
Gaucher disease type 1 -1.400 4.9e-03
glioblastoma 1.300 6.1e-04
group 3 medulloblastoma 1.400 8.3e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.6e-03
juvenile dermatomyositis 1.128 1.9e-09
lung cancer -1.400 3.6e-03
medulloblastoma, large-cell 2.200 2.0e-05
non primary Sjogren syndrome sicca 1.100 2.7e-02
osteosarcoma 1.321 1.5e-03
ovarian cancer 2.500 3.8e-11
psoriasis 1.200 3.5e-04

Gene RIF (29)

AA Sequence

MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQD      1 - 70
NNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRKETSARSLGSPLLHERGNIEK     71 - 140
TFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVPIQCTDKTDKQEALFKPQAKDDINRGAPSIT    141 - 210
SVTPRGLCRDEEDTSFESLSKFNVKFPPMDNDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNF    211 - 280
VKTEETLFEIQGIDPIASAIQNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDA    281 - 350
PFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH    351 - 420
FNGET                                                                     421 - 425
//

Text Mined References (69)

PMID Year Title