Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.15
PubTator Score 4.83

Knowledge Summary


No data available


  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.800 6.6e-27
glioblastoma multiforme 1.900 4.9e-28
oligodendroglioma 1.700 2.0e-15
osteosarcoma 2.171 2.6e-05
primitive neuroectodermal tumor 1.100 2.1e-02
Duchenne muscular dystrophy 1.083 2.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.061 6.0e-03
juvenile dermatomyositis 1.514 8.0e-11
primary pancreatic ductal adenocarcinoma 1.666 6.0e-04
pediatric high grade glioma 1.400 4.2e-04
pilocytic astrocytoma 2.100 1.9e-06
subependymal giant cell astrocytoma 1.332 3.3e-02
lung adenocarcinoma -1.300 1.5e-14
lung carcinoma -1.600 2.8e-15
ovarian cancer -1.900 2.7e-06
pancreatic cancer 1.300 8.1e-04

Gene RIF (1)

15673434 Discusses cloning and expression of Rat TANC1 and preliminary cloning of human TANC1, which resulted in recovery of a partial cDNA.

AA Sequence

KTVSHLYQESISKQQPHISNEAHRSHLTAAKPKRSFIESNV                                1821 - 1861

Text Mined References (18)

PMID Year Title
24974847 2014 A three-stage genome-wide association study identifies a susceptibility locus for late radiotherapy toxicity at 2q24.1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22182840 2012 Drosophila and mammalian models uncover a role for the myoblast fusion gene TANC1 in rhabdomyosarcoma.
21739571 2011 Complex chromosomal rearrangement in a girl with psychomotor-retardation and a de novo inversion: inv(2)(p15;q24.2).
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18930710 2008 MINK is a Rap2 effector for phosphorylation of the postsynaptic scaffold protein TANC1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15673434 2005 A novel scaffold protein, TANC, possibly a rat homolog of Drosophila rolling pebbles (rols), forms a multiprotein complex with various postsynaptic density proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.