Property Summary

NCBI Gene PubMed Count 104
PubMed Score 251.22
PubTator Score 209.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer 1.100 1.7e-02
psoriasis -1.500 3.1e-03
osteosarcoma -5.986 1.3e-10
medulloblastoma, large-cell -1.300 2.7e-05
tuberculosis 1.800 4.6e-05
non-small cell lung cancer -1.981 9.5e-25
lung cancer -2.800 3.2e-05
interstitial cystitis 1.400 1.3e-05
pancreatic carcinoma 1.100 1.7e-02
lung adenocarcinoma -1.551 4.2e-22
ductal carcinoma in situ -1.300 3.8e-04
invasive ductal carcinoma -1.700 1.3e-03

Gene RIF (65)

PMID Text
27052461 Concurrent exogenous expression of three transcription factors, GATA1, FLI1 and TAL1, enables large-scale production of megakaryocytes from human pluripotent stem cells.
26053062 a successful induction of gamma-globin includes a reduction in BCL11A, KLF1 and TAL1 expression.
25971621 analysis of a point mutation that increases fetal globin expression through de novo recruitment of the activator TAL1 to promote chromatin looping of distal enhancers to the modified gamma-globin promoter
25564442 Scl binds to primed enhancers in mesoderm to regulate hematopoietic and cardiac fate divergence.
25528728 These results indicate that KLF1 plays a role in facilitating and/or stabilizing GATA-1 and TAL1 occupancy in the erythroid genes, contributing to the generation of active chromatin structure such as histone acetylation and chromatin looping
25394790 study found that heterozygous somatic mutations are acquired that introduce binding motifs for the MYB transcription factor in a precise noncoding site, which creates a super-enhancer upstream of the TAL1 oncogene; MYB binds to this new site
25292191 SCL-mediated transcriptional network enhances megakaryocytic specification of human embryonic stem cells.
24470145 The results indicate that TAL1 plays a critical role in chromatin loop formation between the gamma-globin genes and locus control region, which is a critical step for the transcription of the gamma-globin genes.
24405580 SCL/TAL1 is located in the up-stream of MEK/ERK pathway and partially regulates hematopoiesis by modulating the phosphorylation level of the key proteins in MEK/ERK pathway.
24395799 TAL1 is involved in regulating H3K27me3 variations in collaboration with GFI1B
24249258 There is occurrence of TAL1 and MYC translocations in early thymocyte ontogeny, but subsequent oncogenic alterations were required to drive oncogenesis in T-cell acute lymphoblastic leukemia.
24200685 These findings redefine how TAL1 and neighboring genes communicate within the nucleus, and indicate that looping facilitates both normal and aberrant TAL1 expression and may predispose to structural rearrangements in T-cell acute lymphoblastic leukemia.
24040098 SIL-TAL1 rearrangement identifies a distinct subtype with inferior outcome which could allow for individual therapeutic stratification for T-ALL patients.
23857984 The TAL1 complex targets the FBXW7 tumor suppressor by activating miR-223 in human T cell acute lymphoblastic leukemia.
23698277 our study reveals a novel molecular mechanism involving changes in three-dimensional chromatin interactions that activate the TAL1 oncogene in human T-cell leukemia.
23448994 We validate a small set of TAL1-regulated microRNA genes whose role is important in T-cell acute lymphoblastic leukemia.
23327922 Transcriptional regulators cooperate to establish or maintain primitive stem cell-like signatures in leukemic cells.
22982397 TAL1 binds to the EPO-R promoter to activate EPO-R expression
22897851 TAL1 forms a positive interconnected autoregulatory loop with GATA3 and RUNX1 and that the TAL1 complex directly activates the MYB oncogene.
22773876 a novel role for GATA-4 and TAL1 to affect skeletal myogenic differentiation and EPO response via cross-talk with Sirt1.
22310283 Consistent with the dual roles of TAL1 in transcription, TAL1-associated LSD1 is decreased while recruitment of hSET1 is increased at the TAL1 targets during erythroid differentiation
21937587 SCL was the 11th most upregulated transcript during the first 4 days of the human embryonic stem cells differentiation process.
21647153 results indicate that the HDACi-mediated apoptotic program in T-ALL cells is partially dependent on their capacity to downregulate TAL1 and provide support for the therapeutic use of HDACi in T-ALL
21571218 The genome-wide binding sites for the SCL in primary human megakaryocytes to identify the essential regulator of complex mammalian differentiation processes.
21474105 regulation of adult hematopoiesis through TIF1gamma-mediated transcriptional repression of TAL1 and PU.1 target genes.
21407147 The association between single nucleotide polymorphisms (SNPs) of the TAL1 gene, one of the candidate genes of leukemia and schizophrenia, is reported.
21179004 TAL1 interacts with RUNX1 and ETS1, and that these transcription factors are critically required for TAL1 binding to genes that modulate T-cell differentiation.
20855495 in human TAL1-expressing T-ALL cell lines, TAL1 directly activates NKX3.1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20140202 Data open up several areas for further investigation and adds new layers of complexity to our understanding of the regulation of SCL expression.
20028976 Tal1 expression activated UBE2H expression, whereas Tal1 knock-down reduced UBE2H expression and ubiquitin transfer activity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19865112 Observational study of gene-disease association. (HuGE Navigator)
19785037 Generated high-level hematopoietic chimeras using donor cells from mice transgenic for the stem cell leukaemia 3' enhancer human placental alkaline phosphatase reporter construct to demonstrate vascular contribution potential of fetal liver cells.
19587703 observations support a model in which Tax and TAL1 by repressing hTERT would initially favor genomic instability, whereas expression of factors such as HBZ allows at a later stage an increase in hTERT production and consequently in telomerase activity
19527627 TAL-1, a basic-helix-loop-helix transcription factor, plays a key role in the formation and functioning of both blood and endothelial systems. Review.
19497860 LSD1 may negatively regulate TAL1-mediated transcription and suggest that the dynamic regulation of TAL1-associated LSD1/HDAC1
19406989 The intracellular concentration of TAL1 is regulated by TGF-beta, which triggers its polyubiquitylation & degradation by the proteasome. This is mediated by AKT1, which phosphorylates TAL1 at threonine 90.
18550854 different mechanisms of SCL's action predominate depending on the developmental/cellular context
18495761 analysis of cross talk between the human T-cell leukemia virus type 1 Tax transactivator and the oncogenic bHLH transcription factor TAL1
18439091 TAL-1 deletion is associated with T-cell acute lymphoblastic leukemia.
18436863 Data definitively delineate the human myeloid progenitors that are regulated by TAL1.
18187418 LMO2, TAL1, Ttg-1, and SIL support levels of V(D)J recombination above background levels in cell culture and are also cleaved by the RAG proteins, while Hox11 and SCL are nicked but not cleaved efficiently in vitro
17962192 Operation of cullin-based ubiquitin ligase complexes and potential means by which Notch and Tal1/SCL regulate eukaryotic development.
17910069 characterize the assembly of a five-component complex containing TAL1, LMO2, Ldb1, E12, and DNA. The bHLH domains of TAL1 and E12 alone primarily formed helical homodimers, but together formed heterodimers, to which LMO2 bound with high affinity
17878155 the SCL-LMO2 interaction couples protein stabilization with higher order protein complex assembly, thus providing a powerful means of modulating the stoichiometry and spatiotemporal activity of SCL complexes
17507663 CD3epsilon-mediated signal transduction pathway is essential for this transformation process
17460775 Conditional activation of the SCL transgene under control of ubiquitously expressed SCL interrupting locus (SIL) transgenic regulatory elements impairs normal T-cell development.
16849639 Using lentiviral delivery of TAL1-directed shRNA in human hematopoietic cells showed that decreased expression of TAL1 induced major disorders at different levels of adult hematopoietic cell development
16778171 TAL1 modulates NFKB1 expression and an NF-kappaB-dependent transcriptional program in a subset of human T-cell leukemia cells.
16763211 Scl acts up-stream of NF-E2 expression to control megakaryocyte development and platelet release in settings of thrombopoietic stress
16621969 TAL1 may act as a bifunctional transcriptional regulator (activator and repressor) at the top of a complex regulatory network that disrupts normal T-cell homeostasis and contributes to leukemogenesis.
16298389 PU.1, in addition to its positive role in TAL-1 expression in early hematopoietic progenitors, may also act as a mediator of TAL-1 silencing in some hematopoietic lineages
15961517 TAL1 expression level regulates immature human hematopoietic cell self-renewal and this regulation requires TAL1 DNA-binding activity
15923636 Results show striking coexpression of SCL and its immediate downstream neighbor, MAP17, suggesting that they share regulatory elements.
15677454 Tal1/SCL binding to pericentromeric DNA represses transcription
15086455 Possible role for SCL in renal vasculogenesis. Undifferentiated mesenchymal cells expressing SCL during early nephrogenesis might represent putative progenitors that can simultaneously give rise to kidney, blood, and endothelium.
14970264 TAL-1 modulates the angiogenic response of endothelial cells by stimulating cell morphogenesis and by influencing their behavior in migration.
14715640 Enforced expression of a TAL1 protein deleted of its DNA-binding domain mimicked most TAL1 effects except for the LTC-IC enhancement, the down-regulation of the CD34 surface marker, and the GPA(+) cell production
14651981 These results indicate that TAL1 can affect both T cell proliferation and differentiation.
12867998 is a survival factor for erythroid cells
12239153 regulates c-kit expression in hematopoietic cells through functional interaction with Sp1
12091340 Ectopic expression of human TAL-1 protein in Ly-6E.1-htal-1 transgenic mice induces defects in B- and T-lymphoid differentiation, but did not cause leukemia.
12010791 SCL locus can rescue knockout scl(-/-) mice
11904294 role of hypoxia in stimulating phosphorylation, ubiquitination, and proteasomal breakdown in endothelial cells

AA Sequence

MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGPGGGPAGGGGA      1 - 70
ARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSL     71 - 140
SQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAEL    141 - 210
RKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDL    211 - 280
LQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR                       281 - 331
//

Text Mined References (106)

PMID Year Title
27052461 2016 Large-scale production of megakaryocytes from human pluripotent stem cells by chemically defined forward programming.
26053062 2015 Variation in Gamma-Globin Expression before and after Induction with Hydroxyurea Associated with BCL11A, KLF1 and TAL1.
25971621 2015 Editing the genome to introduce a beneficial naturally occurring mutation associated with increased fetal globin.
25564442 2015 Scl binds to primed enhancers in mesoderm to regulate hematopoietic and cardiac fate divergence.
25528728 2015 KLF1 stabilizes GATA-1 and TAL1 occupancy in the human ?-globin locus.
25394790 2014 Oncogene regulation. An oncogenic super-enhancer formed through somatic mutation of a noncoding intergenic element.
25292191 2015 SCL/TAL1-mediated transcriptional network enhances megakaryocytic specification of human embryonic stem cells.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24470145 2014 The hematopoietic regulator TAL1 is required for chromatin looping between the ?-globin LCR and human ?-globin genes to activate transcription.
24405580 Transcription factor SCL/TAL1 mediates the phosphorylation of MEK/ERK pathway in umbilical cord blood CD34? stem cells during hematopoietic differentiation.
24395799 2014 Analysis of chromatin-state plasticity identifies cell-type-specific regulators of H3K27me3 patterns.
24249258 2014 MYC fails to efficiently shape malignant transformation in T-cell acute lymphoblastic leukemia.
24200685 2013 Chromatin looping defines expression of TAL1, its flanking genes, and regulation in T-ALL.
24040098 2013 SIL-TAL1 rearrangement is related with poor outcome: a study from a Chinese institution.
23857984 2013 The TAL1 complex targets the FBXW7 tumor suppressor by activating miR-223 in human T cell acute lymphoblastic leukemia.
23698277 2014 Aberrant TAL1 activation is mediated by an interchromosomal interaction in human T-cell acute lymphoblastic leukemia.
23448994 2013 Novel TAL1 targets beyond protein-coding genes: identification of TAL1-regulated microRNAs in T-cell acute lymphoblastic leukemia.
23327922 2013 Activity of a heptad of transcription factors is associated with stem cell programs and clinical outcome in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22982397 2012 T-cell acute leukemia 1 (TAL1) regulation of erythropoietin receptor and association with excessive erythrocytosis.
22897851 2012 Core transcriptional regulatory circuit controlled by the TAL1 complex in human T cell acute lymphoblastic leukemia.
22773876 2012 GATA-binding protein 4 (GATA-4) and T-cell acute leukemia 1 (TAL1) regulate myogenic differentiation and erythropoietin response via cross-talk with Sirtuin1 (Sirt1).
22310283 2012 Dynamic interaction between TAL1 oncoprotein and LSD1 regulates TAL1 function in hematopoiesis and leukemogenesis.
21937587 2011 Large-scale transcriptional profiling and functional assays reveal important roles for Rho-GTPase signalling and SCL during haematopoietic differentiation of human embryonic stem cells.
21647153 2011 TAL1/SCL is downregulated upon histone deacetylase inhibition in T-cell acute lymphoblastic leukemia cells.
21571218 2011 Genome-wide analysis of simultaneous GATA1/2, RUNX1, FLI1, and SCL binding in megakaryocytes identifies hematopoietic regulators.
21474105 2011 Adult hematopoiesis is regulated by TIF1?, a repressor of TAL1 and PU.1 transcriptional activity.
21407147 2012 Association between polymorphisms of TAL1 gene and schizophrenia in a Korean population.
21179004 2011 Differential genomic targeting of the transcription factor TAL1 in alternate haematopoietic lineages.
20855495 2010 NKX3.1 is a direct TAL1 target gene that mediates proliferation of TAL1-expressing human T cell acute lymphoblastic leukemia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20140202 2010 Genomic approaches uncover increasing complexities in the regulatory landscape at the human SCL (TAL1) locus.
20028976 2010 Targets of the Tal1 transcription factor in erythrocytes: E2 ubiquitin conjugase regulation by Tal1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19865112 2010 Mutual exclusion of ASXL1 and NPM1 mutations in a series of acute myeloid leukemias.
19785037 2010 Enhanced hematovascular contribution of SCL 3' enhancer expressing fetal liver cells uncovers their potential to integrate in extramedullary adult niches.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19587703 2009 Inhibition of the hTERT promoter by the proto-oncogenic protein TAL1.
19527627 2009 [The bHLH TAL1 protein: a key molecule in the hematopoietic and endothelial systems].
19497860 2009 LSD1-mediated epigenetic modification is required for TAL1 function and hematopoiesis.
19406989 2009 TGF-beta induces degradation of TAL1/SCL by the ubiquitin-proteasome pathway through AKT-mediated phosphorylation.
18550854 2008 Differential use of SCL/TAL-1 DNA-binding domain in developmental hematopoiesis.
18495761 2008 Cross talk between expression of the human T-cell leukemia virus type 1 Tax transactivator and the oncogenic bHLH transcription factor TAL1.
18439091 Does TAL-1 deletion contribute to the high incidence of T-cell acute lymphoblastic leukemia in South Indian patients?
18436863 2008 Impairment of granulo-monocytic development of human common myeloid progenitors but not of granulo-monocytic progenitors by decreasing stem cell leukemia/T-cell acute leukemia 1 expression.
18187418 2008 V(D)J recombinase binding and cleavage of cryptic recombination signal sequences identified from lymphoid malignancies.
17962192 2008 Ubiquitination and degradation of Tal1/SCL are induced by notch signaling and depend on Skp2 and CHIP.
17910069 2008 Assembly of the oncogenic DNA-binding complex LMO2-Ldb1-TAL1-E12.
17878155 2007 Protein stability and transcription factor complex assembly determined by the SCL-LMO2 interaction.
17507663 2007 p16INK4A tumor suppressor gene expression and CD3epsilon deficiency but not pre-TCR deficiency inhibit TAL1-linked T-lineage leukemogenesis.
17503961 2007 Isoform-specific potentiation of stem and progenitor cell engraftment by AML1/RUNX1.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17460775 2007 Cre-loxP-mediated recombination between the SIL and SCL genes leads to a block in T-cell development at the CD4- CD8- to CD4+ CD8+ transition.
16849639 2006 Low SCL/TAL1 expression reveals its major role in adult hematopoietic myeloid progenitors and stem cells.
16778171 2006 NFKB1 is a direct target of the TAL1 oncoprotein in human T leukemia cells.
16763211 2006 A critical role for the transcription factor Scl in platelet production during stress thrombopoiesis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16621969 2006 Transcriptional regulatory networks downstream of TAL1/SCL in T-cell acute lymphoblastic leukemia.
16298389 2006 PU.1/Spi-1 binds to the human TAL-1 silencer to mediate its activity.
15961517 2005 SCL/TAL1 expression level regulates human hematopoietic stem cell self-renewal and engraftment.
15923636 2005 Transcriptional regulation of the SCL locus: identification of an enhancer that targets the primitive erythroid lineage in vivo.
15920471 2005 GATA-1 forms distinct activating and repressive complexes in erythroid cells.
15677454 2005 Tal1/SCL binding to pericentromeric DNA represses transcription.
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15086455 2004 Kidney, blood, and endothelium: developmental expression of stem cell leukemia during nephrogenesis.
14970264 2004 The bHLH TAL-1/SCL regulates endothelial cell migration and morphogenesis.
14729962 2004 More than blood, a novel gene required for mammalian postimplantation development.
14715640 2004 Characterization of DNA-binding-dependent and -independent functions of SCL/TAL1 during human erythropoiesis.
14651981 2003 The basic helix-loop-helix transcription factor TAL1/SCL inhibits the expression of the p16INK4A and pTalpha genes.
12867998 2003 Control of erythroid cell production via caspase-mediated cleavage of transcription factor SCL/Tal-1.
12704079 2003 Translational control of SCL-isoform expression in hematopoietic lineage choice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239153 2002 The SCL complex regulates c-kit expression in hematopoietic cells through functional interaction with Sp1.
12091340 2002 Ectopic expression of TAL-1 protein in Ly-6E.1-htal-1 transgenic mice induces defects in B- and T-lymphoid differentiation.
12010791 2002 Rescue of the lethal scl(-/-) phenotype by the human SCL locus.
11904294 2002 Phosphorylation by mitogen-activated protein kinase mediates the hypoxia-induced turnover of the TAL1/SCL transcription factor in endothelial cells.
11118214 2000 P/CAF-mediated acetylation regulates the function of the basic helix-loop-helix transcription factor TAL1/SCL.
10688671 2000 mSin3A regulates murine erythroleukemia cell differentiation through association with the TAL1 (or SCL) transcription factor.
10490830 1999 p300 functions as a transcriptional coactivator for the TAL1/SCL oncoprotein.
9824680 1998 SCL binds the human homologue of DRG in vivo.
9819382 1998 TAL1 and LIM-only proteins synergistically induce retinaldehyde dehydrogenase 2 expression in T-cell acute lymphoblastic leukemia by acting as cofactors for GATA3.
9507011 1998 The Tal1 oncoprotein inhibits E47-mediated transcription. Mechanism of inhibition.
9171354 1997 An scl gene product lacking the transactivation domain induces bony abnormalities and cooperates with LMO1 to generate T-cell malignancies in transgenic mice.
9111058 1997 Target-dependent effect of phosphorylation on the DNA binding activity of the TAL1/SCL oncoprotein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8437851 1993 Products of the TAL1 oncogene: basic helix-loop-helix proteins phosphorylated at serine residues.
8423803 1993 Phosphorylation of the TAL1 oncoprotein by the extracellular-signal-regulated protein kinase ERK1.
8414504 1993 Expression of the TAL1 proto-oncogene in cultured endothelial cells and blood vessels of the spleen.
8159721 1994 Formation of in vivo complexes between the TAL1 and E2A polypeptides of leukemic T cells.
8084606 1994 Expression of lineage restricted transcription factors precedes lineage specific differentiation in a multipotent haemopoietic progenitor cell line.
8078932 1994 The LIM protein RBTN2 and the basic helix-loop-helix protein TAL1 are present in a complex in erythroid cells.
7957052 1994 Specific in vivo association between the bHLH and LIM proteins implicated in human T cell leukemia.
7833471 1995 Expression of TAL-1 proteins in human tissues.
7678994 1993 Expression of tal-1 and GATA-binding proteins during human hematopoiesis.
7568177 1995 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1.
2740341 1989 Involvement of the TCL5 gene on human chromosome 1 in T-cell leukemia and melanoma.
2602361 1989 The gene SCL is expressed during early hematopoiesis and encodes a differentiation-related DNA-binding motif.
2303035 1990 The tal gene undergoes chromosome translocation in T cell leukemia and potentially encodes a helix-loop-helix protein.
2247063 1990 The SCL gene is formed from a transcriptionally complex locus.
2230650 1990 Coding sequences of the tal-1 gene are disrupted by chromosome translocation in human T cell leukemia.
1964581 1990 Two distinct mechanisms for the SCL gene activation in the t(1;14) translocation of T-cell leukemias.
1886719 1991 Two site-specific deletions and t(1;14) translocation restricted to human T-cell acute leukemias disrupt the 5' part of the tal-1 gene.
1453013 1992 SCL and related hemopoietic helix-loop-helix transcription factors.
1450410 1992 T-cell acute lymphoblastic leukemia--the associated gene SCL/tal codes for a 42-Kd nuclear phosphoprotein.
1396592 1992 The SCL gene product: a positive regulator of erythroid differentiation.
1311214 1992 Involvement of the putative hematopoietic transcription factor SCL in T-cell acute lymphoblastic leukemia.