Property Summary

NCBI Gene PubMed Count 35
PubMed Score 18.83
PubTator Score 17.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.700 2.4e-03
Astrocytoma, Pilocytic 2.200 3.0e-08
gastric cancer 1.100 1.2e-02
glioblastoma 1.500 1.0e-03
interstitial cystitis 1.200 1.3e-02
intraductal papillary-mucinous carcinoma... -1.200 1.3e-02
invasive ductal carcinoma 1.721 5.7e-03
lung carcinoma -1.500 7.6e-20
non primary Sjogren syndrome sicca -1.200 2.4e-02
non-small cell lung cancer -1.361 2.4e-09
osteosarcoma -2.314 3.8e-02
ovarian cancer -3.000 1.2e-10
periodontitis 1.200 6.4e-24
sarcoidosis 1.400 4.6e-02
subependymal giant cell astrocytoma 1.782 5.0e-02
ulcerative colitis 1.300 5.0e-03

Synonym

Accession Q8N103 Q2NKM8 Q8NI40 Q96KZ2 Q96QA2
Symbols FKSG15
IDDM21
TAGAP1
ARHGAP47

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (19)

AA Sequence

MKLRSSHNASKTLNANNMETLIECQSEGDIKEHPLLASCESEDSICQLIEVKKRKKVLSWPFLMRRLSPA      1 - 70
SDFSGALETDLKASLFDQPLSIICGDSDTLPRPIQDILTILCLKGPSTEGIFRRAANEKARKELKEELNS     71 - 140
GDAVDLERLPVHLLAVVFKDFLRSIPRKLLSSDLFEEWMGALEMQDEEDRIEALKQVADKLPRPNLLLLK    141 - 210
HLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQSLSFEAQKDLNNKVKTLVEFLIDNCFEIFGEN    211 - 280
IPVHSSITSDDSLEHTDSSDVSTLQNDSAYDSNDPDVESNSSSGISSPSRQPQVPMATAAGLDSAGPQDA    281 - 350
REVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSSQECLESRVTNQTLTKSEGDFPVPRVGSRLESEEAED    351 - 420
PFPEEVFPAVQGKTKRPVDLKIKNLAPGSVLPRALVLKAFSSSSLDASSDSSPVASPSSPKRNFFSRHQS    421 - 490
FTTKTEKGKPSREIKKHSMSFTFAPHKKVLTKNLSAGSGKSQDFTRDHVPRGVRKESQLAGRIVQENGCE    491 - 560
THNQTARGFCLRPHALSVDDVFQGADWERPGSPPSYEEAMQGPAARLVASESQTVGSMTVGSMRARMLEA    561 - 630
HCLLPPLPPAHHVEDSRHRGSKEPLPGHGLSPLPERWKQSRTVHASGDSLGHVSGPGRPELLPLRTVSES    631 - 700
VQRNKRDCLVRRCSQPVFEADQFQYAKESYI                                           701 - 731
//

Text Mined References (36)

PMID Year Title