Property Summary

NCBI Gene PubMed Count 9
PubMed Score 23.53
PubTator Score 6.42

Knowledge Summary


No data available



  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 1.9e-03
group 4 medulloblastoma 1.300 2.4e-02
intraductal papillary-mucinous neoplasm ... -1.100 1.1e-02
lung carcinoma 1.200 4.2e-19
osteosarcoma 3.227 1.3e-04
ovarian cancer -1.800 1.0e-06
Pick disease -1.100 8.3e-03

 MGI Phenotype (1)

Gene RIF (2)

AA Sequence

PSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM                                 211 - 251

Text Mined References (14)

PMID Year Title