Property Summary

NCBI Gene PubMed Count 9
PubMed Score 23.31
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 3.227 1.3e-04
ependymoma 1.200 1.9e-03
group 4 medulloblastoma 1.300 2.4e-02
intraductal papillary-mucinous neoplasm ... -1.100 1.1e-02
lung carcinoma 1.200 4.2e-19
Pick disease -1.100 8.3e-03
ovarian cancer -1.800 1.0e-06

Synonym

Accession Q9HBM6 B2RUZ9 Q9Y2S3
Symbols DN7
DN-7
TAF9L
TAFII31L
TFIID-31

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Protein-protein Interaction (9)

Gene RIF (2)

PMID Text
15899866 TAF9b (TAF9L) was identified as a subunit of TFIID.
12837753 RNA interference experiments suggest that TAF9L is essential for HeLa cell growth and this protein is involved in transcriptional repression.

AA Sequence

MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADD      1 - 70
VRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQG     71 - 140
RLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLIN    141 - 210
PSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM                                 211 - 251
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15899866 2005 TAF9b (formerly TAF9L) is a bona fide TAF that has unique and overlapping roles with TAF9.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12837753 2003 In vivo functional analysis of the histone 3-like TAF9 and a TAF9-related factor, TAF9L.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10721692 2000 TAFs revisited: more data reveal new twists and confirm old ideas.
7761466 1995 Human TAFII31 protein is a transcriptional coactivator of the p53 protein.