Property Summary

NCBI Gene PubMed Count 11
PubMed Score 126.25
PubTator Score 142.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.2e-05
ependymoma 4679 7.9e-03
Disease Target Count Z-score Confidence
Poland syndrome 14 3.971 2.0
Osteoporosis 363 3.584 1.8
Anorexia nervosa 80 3.068 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma -1.100 7.9e-03
osteosarcoma -1.758 3.2e-05

Protein-protein Interaction (15)

Gene RIF (11)

AA Sequence

MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYIS      1 - 70
EIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNR     71 - 140
PHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVST    141 - 210
FPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLS    211 - 280
GSRNGEENIIDNPYLRPVKKPKIRRKKSLS                                            281 - 310
//

Text Mined References (18)

PMID Year Title