Property Summary

NCBI Gene PubMed Count 43
PubMed Score 12.59
PubTator Score 22.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Multiple myeloma 1327 5.4e-04
ovarian cancer 8491 4.4e-03
Waldenstrons macroglobulinemia 764 2.5e-02
Disease Target Count Z-score Confidence
Asthma 349 0.0 1.0
Disease Target Count Z-score Confidence
Epidermodysplasia verruciformis 21 3.974 2.0
Trophoblastic neoplasm 1 3.153 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.283 2.5e-02
Multiple myeloma 1.935 5.4e-04
ovarian cancer 1.600 4.4e-03

Protein-protein Interaction (7)

Gene RIF (20)

PMID Text
25575120 the MED26-NTD functions as a molecular switch in the exchange of TBP-associated factor 7 (TAF7) for LEC to facilitate the transition from initiation to elongation during transcription of a subset of snRNA genes
25412659 These results resolve the structural organization of the TAF1-TAF7 module in TFIID and unveil a critical promoter-binding function of TAF1 in transcription regulation.
24927529 the surface of the TAF1-TAF7 complex contains two prominent conserved surface pockets, one of which binds selectively to an inhibitory trimethylated histone H3
23027873 three CTD kinases, CDK7, CDK9, and BRD4, engage in cross-talk, modulating their subsequent C-terminal domain phosphorylation, and also phosphorylate TAF7
22711989 analysis of phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7
20937824 TAF7, until now considered only a TFIID component and regulator of TAF1-dependent transcription, also regulates TAF1-independent transcription
18391197 TAF7 interacts with the transcription factors, TFIIH and P-TEFb, resulting in the inhibition of their Pol II CTD kinase activities
17320040 These results suggest normal TBP-binding interactions--specifically recognition, stability, and conformation-are disrupted by CldAMP insertion into eukaryotic promoter sequences.
16407123 Functions as a check-point regulator suppressing premature transcription initiation until preinitiation complex assembly is complete.
15078871 TAF7 has a role as a basal regulator for mammalian polyamine transport activity and MGBG-induced apoptosis
12676957 TAF7 represents a novel c-Jun co-activator mediating activation of AP-1 target genes in response to extracellular signals
9054383 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8849451 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8764062 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8764009 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8680883 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8121496 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
7933101 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
7836461 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
7835343 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47

AA Sequence

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDL      1 - 70
PCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPL     71 - 140
KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQG    141 - 210
HDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMG    211 - 280
IQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK     281 - 349
//

Text Mined References (53)

PMID Year Title
27007846 2016 Structure of promoter-bound TFIID and model of human pre-initiation complex assembly.
25575120 2015 MED26 regulates the transcription of snRNA genes through the recruitment of little elongation complex.
25412659 2014 Crystal structure of a TAF1-TAF7 complex in human transcription factor IID reveals a promoter binding module.
24927529 2014 Structural and functional insight into TAF1-TAF7, a subcomplex of transcription factor II D.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036077 2013 Transcriptional coactivator CIITA, a functional homolog of TAF1, has kinase activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027873 2012 Cross-talk among RNA polymerase II kinases modulates C-terminal domain phosphorylation.
22711989 2012 Phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20937824 2010 Novel functions for TAF7, a regulator of TAF1-independent transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391197 2008 TFIID component TAF7 functionally interacts with both TFIIH and P-TEFb.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17320040 2007 Presence of the anti-leukemic nucleotide analog, 2-chloro-2'-deoxyadenosine-5'-monophosphate, in a promoter sequence alters DNA binding of TATA-binding protein (TBP).
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16415881 2006 Structural basis for the methylation site specificity of SET7/9.
16407123 2006 TAF7: a possible transcription initiation check-point regulator.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15078871 2004 TATA-binding protein-associated factor 7 regulates polyamine transport activity and polyamine analog-induced apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580349 2003 The TBN protein, which is essential for early embryonic mouse development, is an inducible TAFII implicated in adipogenesis.
12676957 2003 TAF7 (TAFII55) plays a role in the transcription activation by c-Jun.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11592977 2001 TAFII55 binding to TAFII250 inhibits its acetyltransferase activity.
11564863 2001 Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo.
11340078 2001 The intronless and TATA-less human TAF(II)55 gene contains a functional initiator and a downstream promoter element.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
11005381 2000 Potential targets for HSF1 within the preinitiation complex.
10896937 2000 Assembly of partial TFIID complexes in mammalian cells reveals distinct activities associated with individual TATA box-binding protein-associated factors.
10409738 1999 Human TAF(II)55 interacts with the vitamin D(3) and thyroid hormone receptors and with derivatives of the retinoid X receptor that have altered transactivation properties.
9632676 1998 The putative cofactor TIF1alpha is a protein kinase that is hyperphosphorylated upon interaction with liganded nuclear receptors.
9603525 1998 Function of TAF(II)-containing complex without TBP in transcription by RNA polymerase II.
9488465 1998 EWS, but not EWS-FLI-1, is associated with both TFIID and RNA polymerase II: interactions between two members of the TET family, EWS and hTAFII68, and subunits of TFIID and RNA polymerase II complexes.
9311784 1997 Transcription factor TFIID recruits factor CPSF for formation of 3' end of mRNA.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8794892 1996 Trans-activation by the human aryl hydrocarbon receptor and aryl hydrocarbon receptor nuclear translocator proteins: direct interactions with basal transcription factors.
8764062 1996 Interaction of human immunodeficiency virus type 1 Tat with a unique site of TFIID inhibits negative cofactor Dr1 and stabilizes the TFIID-TFIIA complex.
8764009 1996 Mutations in the carboxy-terminal domain of TBP affect the synthesis of human immunodeficiency virus type 1 full-length and short transcripts similarly.
8702684 1996 Multiple interactions between hTAFII55 and other TFIID subunits. Requirements for the formation of stable ternary complexes between hTAFII55 and the TATA-binding protein.
8680883 1996 Wild-type and transactivation-defective mutants of human immunodeficiency virus type 1 Tat protein bind human TATA-binding protein in vitro.
8121496 1994 Direct interaction of human TFIID with the HIV-1 transactivator tat.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.
7933101 1994 Role of flanking E box motifs in human immunodeficiency virus type 1 TATA element function.
7836461 1995 A novel LBP-1-mediated restriction of HIV-1 transcription at the level of elongation in vitro.
7835343 1995 Novel mechanism and factor for regulation by HIV-1 Tat.
7824954 1995 Cloning of an intrinsic human TFIID subunit that interacts with multiple transcriptional activators.