Property Summary

NCBI Gene PubMed Count 48
PubMed Score 12.48
PubTator Score 20.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8491 2.2e-04
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Cornelia de Lange syndrome 21 3.689 1.8
Malignant fibroxanthoma 8 3.055 1.5
Disease Target Count
Cornelia de Lange syndrome 1 3

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 2.2e-04

 MGI Phenotype (1)

Gene RIF (17)

PMID Text
25025302 data point to several new RNA elements that can modulate TAF6delta and also reveal a role for RNA secondary structure in the selection of TAF6delta
23827503 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22834489 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
22696218 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
20096117 The transcriptome data uncovered novel links between TAF6delta expression and the Notch, oxidative stress response, integrin, p53, p53 feedback loop 2, and angiogenesis pathways.
18628956 TAF6delta has a pivotal node in a signaling pathway that controls gene expression programs and apoptosis in the absence of p53
15601843 histone fold domain mediated interaction enhances the DNA binding activity of each of the TAF6-TAF9 and TAF4b-TAF12 pairs and of a histone-like octamer complex composed of the four TAFs
15328371 a novel protein-protein interaction was observed between TAFII70 (not TAFII80) and GADD45a
9054383 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8849451 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8764062 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8764009 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8680883 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
8121496 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
7933101 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
7836461 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro
7835343 HIV-1 Tat stabilizes the interaction of TFIIA with TFIID, and TFIIA and TFIID are required to reconstitute Tat-specific and TAR-dependent activation of HIV transcription in vitro

AA Sequence

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSD      1 - 70
IDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEG     71 - 140
CQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKP    141 - 210
RSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLI    211 - 280
YLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNN    281 - 350
IQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGA    351 - 420
DHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPT    421 - 490
LTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA    491 - 560
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPP    561 - 630
PASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP                           631 - 677
//

Text Mined References (57)

PMID Year Title
27007846 2016 Structure of promoter-bound TFIID and model of human pre-initiation complex assembly.
25025302 2014 Alternative splicing of TAF6: downstream transcriptome impacts and upstream RNA splice control elements.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22696218 2012 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21269460 2011 Initial characterization of the human central proteome.
20457814 2010 Three key subregions contribute to the function of the downstream RNA polymerase II core promoter.
20096117 2010 TAF6delta orchestrates an apoptotic transcriptome profile and interacts functionally with p53.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18628956 2008 TAF6delta controls apoptosis and gene expression in the absence of p53.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15960975 2005 Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF.
15899866 2005 TAF9b (formerly TAF9L) is a bona fide TAF that has unique and overlapping roles with TAF9.
15601843 2005 Core promoter binding by histone-like TAF complexes.
15564746 2004 Specific in vitro interaction between papillomavirus E2 proteins and TBP-associated factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328371 2004 TAFII70 isoform-specific growth suppression correlates with its ability to complex with the GADD45a protein.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580349 2003 The TBN protein, which is essential for early embryonic mouse development, is an inducible TAFII implicated in adipogenesis.
12829691 2003 Atypical recognition consensus of CIN85/SETA/Ruk SH3 domains revealed by target-assisted iterative screening.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12601814 2003 Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11583621 2001 Identification of hTAF(II)80 delta links apoptotic signaling pathways to transcription factor TFIID function.
11564863 2001 Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo.
11406595 2001 UV-damaged DNA-binding protein in the TFTC complex links DNA damage recognition to nucleosome acetylation.
9603525 1998 Function of TAF(II)-containing complex without TBP in transcription by RNA polymerase II.
9584164 1998 Involvement of TFIID and USA components in transcriptional activation of the human immunodeficiency virus promoter by NF-kappaB and Sp1.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9177216 1997 Transactivation by CIITA, the type II bare lymphocyte syndrome-associated factor, requires participation of multiple regions of the TATA box binding protein.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
9045704 1997 Specific interactions and potential functions of human TAFII100.
8946909 1996 The general transcription factors of RNA polymerase II.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8764062 1996 Interaction of human immunodeficiency virus type 1 Tat with a unique site of TFIID inhibits negative cofactor Dr1 and stabilizes the TFIID-TFIIA complex.
8764009 1996 Mutations in the carboxy-terminal domain of TBP affect the synthesis of human immunodeficiency virus type 1 full-length and short transcripts similarly.
8680883 1996 Wild-type and transactivation-defective mutants of human immunodeficiency virus type 1 Tat protein bind human TATA-binding protein in vitro.
8262073 1993 Cloning and expression of Drosophila TAFII60 and human TAFII70 reveal conserved interactions with other subunits of TFIID.
8121496 1994 Direct interaction of human TFIID with the HIV-1 transactivator tat.
7933101 1994 Role of flanking E box motifs in human immunodeficiency virus type 1 TATA element function.
7836461 1995 A novel LBP-1-mediated restriction of HIV-1 transcription at the level of elongation in vitro.
7835343 1995 Novel mechanism and factor for regulation by HIV-1 Tat.
7667268 1995 Evolutionary conservation of human TATA-binding-polypeptide-associated factors TAFII31 and TAFII80 and interactions of TAFII80 with other TAFs and with general transcription factors.
7644498 1995 The WW domain of Yes-associated protein binds a proline-rich ligand that differs from the consensus established for Src homology 3-binding modules.
7597030 1995 Molecular cloning and expression of the 32-kDa subunit of human TFIID reveals interactions with VP16 and TFIIB that mediate transcriptional activation.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.
826207 1976 Discussion paper: experimental and clinical immunopharmacology data applicable to cancer immunotherapy.