Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.10
PubTator Score 42.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.9e-11
osteosarcoma 7933 1.1e-07
group 4 medulloblastoma 1875 1.1e-03
Disease Target Count Z-score Confidence
Autistic Disorder 320 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.731 1.1e-07
group 4 medulloblastoma 1.100 1.1e-03
ovarian cancer -1.700 1.9e-11

 GWAS Trait (1)

Gene RIF (6)

PMID Text
26023773 hCdc14B promotes reactivation of rDNA transcription by dephosphorylating TAFI110. SIRT1 becomes transiently enriched in nucleoli at the onset of mitosis. SIRT1 deacetylates TAFI68 destabilizing SL1 binding to the rDNA promoter
25551296 Our results indicate that TAF1C gene harboured not only somatic frameshift mutations but also the mutational ITH, which together might play a role in tumourigenesis of gastric and colorectal cancer.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20663923 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16055704 PTEN represses RNA Pol I transcription through a novel mechanism that involves disruption of the SL1 complex
15970593 SL1 directs preinitiation complex formation, functioning in core promoter binding, RNA polymerase I recruitment, and UBF stabilization.

AA Sequence

MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGALHVTKDLLWEPATPGPLPMLP      1 - 70
PLIDPWDPGLTARDLLFRGGCRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTK     71 - 140
KKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGPILGTSVASHLAELLHEELVLRWEQLLLDEA    141 - 210
CTGGALAWVPGRTPQFGQLVYPAGGAQDRLHFQEVVLTPGDNPQFLGKPGRIQLQGPVRQVVTCTVQGES    211 - 280
KALIYTFLPHWLTCYLTPGPFHPSSALLAVRSDYHCAVWKFGKQWQPTLLQAMQVEKGATGISLSPHLPG    281 - 350
ELAICSRSGAVCLWSPEDGLRQIYRDPETLVFRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCG    351 - 420
LLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDERLPLVPMLKWNHGLPSPLLL    421 - 490
ARLLPPPRPSCVQPLLLGGQGGQLQLLHLAGEGASVPRLAGPPQSLPSRIDSLPAFPLLEPKIQWRLQER    491 - 560
LKAPTIGLAAVVPPLPSAPTPGLVLFQLSAAGDVFYQQLRPQVDSSLRRDAGPPGDTQPDCHAPTASWTS    561 - 630
QDTAGCSQWLKALLKVPLAPPVWTAPTFTHRQMLGSTELRREEEEGQRLGVLRKAMARGQLLLQRDLGSL    631 - 700
PAAEPPPAPESGLEDKLSERLGEAWAGRGAAWWERQQGRTSEPGRQTRRPKRRTQLSSSFSLSGHVDPSE    701 - 770
DTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQA    771 - 840
SSVRATRSQQHTPVLSSSQPLRKKPRMGF                                             841 - 869
//

Text Mined References (32)

PMID Year Title
26023773 2015 Cooperative Action of Cdk1/cyclin B and SIRT1 Is Required for Mitotic Repression of rRNA Synthesis.
25551296 2015 Frameshift mutations of TAF1C gene, a core component for transcription by RNA polymerase I, and its regional heterogeneity in gastric and colorectal cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843504 2012 Individual common variants exert weak effects on the risk for autism spectrum disorders.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20663923 2010 A genome-wide scan for common alleles affecting risk for autism.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
17268553 2007 Identification of novel functional TBP-binding sites and general factor repertoires.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16055704 2005 PTEN represses RNA Polymerase I transcription by disrupting the SL1 complex.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
15723054 2005 c-Myc binds to human ribosomal DNA and stimulates transcription of rRNA genes by RNA polymerase I.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226435 2004 Multiple protein-protein interactions by RNA polymerase I-associated factor PAF49 and role of PAF49 in rRNA transcription.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12498690 2002 The cell cycle regulatory factor TAF1 stimulates ribosomal DNA transcription by binding to the activator UBF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11250903 2001 hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters.
11250901 2001 Acetylation of TAF(I)68, a subunit of TIF-IB/SL1, activates RNA polymerase I transcription.
10913176 2000 Repression of RNA polymerase I transcription by the tumor suppressor p53.
10894955 2000 Genomic localization of the human genes TAF1A, TAF1B and TAF1C, encoding TAF(I)48, TAF(I)63 and TAF(I)110 subunits of class I general transcription initiation factor SL1.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
7801123 1994 Reconstitution of transcription factor SL1: exclusive binding of TBP by SL1 or TFIID subunits.