Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.39
PubTator Score 81.94

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (2)

PMID Text
19246067 The authors demonstrate the interaction of both RNA polymerase I and III with hepatitis delta virus RNA, both in vitro and in human cells.
15113842 This study identifies the first nuclear import sequence within the TBP-Associated Factor subunits of Selectivity Factor 1.

AA Sequence

MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW      1 - 70
QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH     71 - 140
ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA    141 - 210
VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY    211 - 280
NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK    281 - 350
YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY    351 - 420
ILKQDHQILGKKIKRMKRSVKKYSIVNPRL                                            421 - 450
//

Text Mined References (21)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
20075868 2010 Nucleolar retention of a translational C/EBPalpha isoform stimulates rDNA transcription and cell size.
19246067 2009 The hepatitis delta virus RNA genome interacts with the human RNA polymerases I and III.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15226435 2004 Multiple protein-protein interactions by RNA polymerase I-associated factor PAF49 and role of PAF49 in rRNA transcription.
15113842 2004 The carboxyl-terminus directs TAF(I)48 to the nucleus and nucleolus and associates with multiple nuclear import receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
11250903 2001 hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters.
11250901 2001 Acetylation of TAF(I)68, a subunit of TIF-IB/SL1, activates RNA polymerase I transcription.
10913176 2000 Repression of RNA polymerase I transcription by the tumor suppressor p53.
10894955 2000 Genomic localization of the human genes TAF1A, TAF1B and TAF1C, encoding TAF(I)48, TAF(I)63 and TAF(I)110 subunits of class I general transcription initiation factor SL1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8013460 1994 TBP-associated factors interact with DNA and govern species specificity of RNA polymerase I transcription.
7801123 1994 Reconstitution of transcription factor SL1: exclusive binding of TBP by SL1 or TFIID subunits.
7491500 1995 Coactivator and promoter-selective properties of RNA polymerase I TAFs.