Property Summary

NCBI Gene PubMed Count 54
PubMed Score 15.20
PubTator Score 48.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.056 2.6e-05
adult high grade glioma -1.100 1.7e-02

Protein-protein Interaction (3)

Gene RIF (36)

AA Sequence

MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGY      1 - 70
ENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHD     71 - 140
SYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFK    141 - 210
NFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTG    211 - 280
KPKGEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRG    281 - 350
GDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG    351 - 420
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDR    421 - 490
GGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGG    491 - 560
DRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY                                          561 - 592
//

Text Mined References (67)

PMID Year Title