Property Summary

NCBI Gene PubMed Count 43
PubMed Score 10.09
PubTator Score 15.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.098 1.6e-05

Gene RIF (15)

PMID Text
25965574 TAF12 and NFYC are transcription factors that regulate the epigenome, whereas RAD54L plays a central role in DNA repair
23426901 ATF7 interacts with TAF12 and contributes to the hypersensitivity of OCL precursors to 1,25-(OH)D in PD.
19635797 Findings suggest that DNA binding by TAF4/4b-TAF12 facilitates the association of TFIID with the core promoter of a subset of genes.
17268553 TAF12 hitherto regarded as RNA polymerase II (RNAP II)-specific was found to be also involved in RNAP I transcription.
15601843 histone fold domain mediated interaction enhances the DNA binding activity of each of the TAF6-TAF9 and TAF4b-TAF12 pairs and of a histone-like octamer complex composed of the four TAFs
12237304 Data present the crystal structure of a complex formed by the interacting domains from two subunits of the general transcription factor TFIID, the human TATA binding protein-associated factors hTAF4 (hTAF(II)135) and hTAF12 (hTAF(II)20).
9054383 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8849451 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8764062 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8764009 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8680883 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8121496 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
7933101 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
7836461 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
7835343 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47

AA Sequence

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREV      1 - 70
DPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYK     71 - 140
KACTTEAHKQRMALIRKTTKK                                                     141 - 161
//

Text Mined References (48)

PMID Year Title
25965574 2015 Cross-Species Genomics Identifies TAF12, NFYC, and RAD54L as Choroid Plexus Carcinoma Oncogenes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23426901 2013 Role of ATF7-TAF12 interactions in the vitamin D response hypersensitivity of osteoclast precursors in Paget's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19635797 2009 TAF4/4b x TAF12 displays a unique mode of DNA binding and is required for core promoter function of a subset of genes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17268553 2007 Identification of novel functional TBP-binding sites and general factor repertoires.
17264123 2007 Sumoylation delays the ATF7 transcription factor subcellular localization and inhibits its transcriptional activity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15735663 2005 A functional interaction between ATF7 and TAF12 that is modulated by TAF4.
15601843 2005 Core promoter binding by histone-like TAF complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14580349 2003 The TBN protein, which is essential for early embryonic mouse development, is an inducible TAFII implicated in adipogenesis.
12601814 2003 Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237304 2002 Crystal structure of a subcomplex of human transcription factor TFIID formed by TATA binding protein-associated factors hTAF4 (hTAF(II)135) and hTAF12 (hTAF(II)20).
11564863 2001 Human STAGA complex is a chromatin-acetylating transcription coactivator that interacts with pre-mRNA splicing and DNA damage-binding factors in vivo.
11438666 2001 The TFIID components human TAF(II)140 and Drosophila BIP2 (TAF(II)155) are novel metazoan homologues of yeast TAF(II)47 containing a histone fold and a PHD finger.
11406595 2001 UV-damaged DNA-binding protein in the TFTC complex links DNA damage recognition to nucleosome acetylation.
10594036 2000 The human TFIID components TAF(II)135 and TAF(II)20 and the yeast SAGA components ADA1 and TAF(II)68 heterodimerize to form histone-like pairs.
9885574 1998 The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily.
9674425 1998 Histone-like TAFs within the PCAF histone acetylase complex.
9603525 1998 Function of TAF(II)-containing complex without TBP in transcription by RNA polymerase II.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9311784 1997 Transcription factor TFIID recruits factor CPSF for formation of 3' end of mRNA.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
9045704 1997 Specific interactions and potential functions of human TAFII100.
8946909 1996 The general transcription factors of RNA polymerase II.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8764062 1996 Interaction of human immunodeficiency virus type 1 Tat with a unique site of TFIID inhibits negative cofactor Dr1 and stabilizes the TFIID-TFIIA complex.
8764009 1996 Mutations in the carboxy-terminal domain of TBP affect the synthesis of human immunodeficiency virus type 1 full-length and short transcripts similarly.
8680883 1996 Wild-type and transactivation-defective mutants of human immunodeficiency virus type 1 Tat protein bind human TATA-binding protein in vitro.
8663456 1996 Cloning and characterization of human TAF20/15. Multiple interactions suggest a central role in TFIID complex formation.
8647459 1996 Isolation and characterization of a cDNA encoding a novel human transcription factor TFIID subunit containing similarities with histones H2B and H3.
8598932 1996 A histone octamer-like structure within TFIID.
8121496 1994 Direct interaction of human TFIID with the HIV-1 transactivator tat.
7933101 1994 Role of flanking E box motifs in human immunodeficiency virus type 1 TATA element function.
7836461 1995 A novel LBP-1-mediated restriction of HIV-1 transcription at the level of elongation in vitro.
7835343 1995 Novel mechanism and factor for regulation by HIV-1 Tat.
7729427 1995 Cloning and characterization of hTAFII18, hTAFII20 and hTAFII28: three subunits of the human transcription factor TFIID.
7667268 1995 Evolutionary conservation of human TATA-binding-polypeptide-associated factors TAFII31 and TAFII80 and interactions of TAFII80 with other TAFs and with general transcription factors.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.