| Tbio | Transcriptional adapter 2-alpha |
Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4. Required for the function of some acidic activation domains, which activate transcription from a distant site (By similarity). Binds double-stranded DNA. Binds dinucleosomes, probably at the linker region between neighboring nucleosomes. Plays a role in chromatin remodeling.
Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Several alternatively spliced transcript variants encoding different isoforms of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Oct 2009]
Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Several alternatively spliced transcript variants encoding different isoforms of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Oct 2009]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| osteosarcoma | 7933 | 6.4e-09 |
| glioblastoma | 5572 | 3.9e-07 |
| malignant mesothelioma | 3163 | 2.6e-06 |
| atypical teratoid / rhabdoid tumor | 4369 | 1.9e-05 |
| pediatric high grade glioma | 2712 | 1.0e-04 |
| lung cancer | 4473 | 6.2e-04 |
| psoriasis | 6685 | 3.7e-03 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Chromosome 17q12 deletion syndrome | 16 | 5.43 | 2.7 |
| VACTERL association | 23 | 4.335 | 2.2 |
| Esophageal atresia | 25 | 3.358 | 1.7 |
| Congenital diaphragmatic hernia | 44 | 3.149 | 1.6 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | 1.900 | 2.6e-06 |
| psoriasis | -1.100 | 3.7e-03 |
| osteosarcoma | -2.499 | 6.4e-09 |
| atypical teratoid / rhabdoid tumor | -1.300 | 1.9e-05 |
| glioblastoma | -1.500 | 3.9e-07 |
| lung cancer | 1.200 | 6.2e-04 |
| pediatric high grade glioma | -1.100 | 1.0e-04 |
| PMID | Text | |
|---|---|---|
| 26468280 | results thus demonstrate that the catalytic activity of GCN5 is stimulated by subunits of the ADA2a- or ADA2b-containing HAT modules and is further increased by incorporation of the distinct HAT modules in the ATAC or SAGA holo-complexes | |
| 25492086 | Single nucleotide polymorphism in ADA2 gene is associated with type 1 diabetes. | |
| 22644376 | CCDC134 increased the PCAF-dependent K320 acetylation of p53 and p53 protein stability in the presence of hADA2a overexpression. | |
| 20602615 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18059173 | hADA2a and hADA3 as crucial cofactors of beta-catenin that are likely involved in the assembly of transactivation-competent beta-catenin complexes at Wnt target genes. | |
| 16299514 | The three-dimensional solution structure of the SWIRM domain from the human transcriptional adaptor ADA2alpha was reported. |
MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPV 1 - 70 LDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTA 71 - 140 DTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDI 141 - 210 YHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELR 211 - 280 REIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPS 281 - 350 IPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALI 351 - 420 KIDVNKTRKIYDFLIREGYITKG 421 - 443 //
| PMID | Year | Title | |
|---|---|---|---|
| 26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. | |
| 26468280 | 2015 | Subunits of ADA-two-A-containing (ATAC) or Spt-Ada-Gcn5-acetyltrasferase (SAGA) Coactivator Complexes Enhance the Acetyltransferase Activity of GCN5. | |
| 25492086 | 2015 | Genetic factors adaptive in a malarial environment may increase the risk of type 1 diabetes. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 23535730 | 2013 | GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22644376 | 2012 | CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest. | |
| 20602615 | 2010 | Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol? | |
| 19103755 | 2009 | The double-histone-acetyltransferase complex ATAC is essential for mammalian development. | |
| 18059173 | 2008 | hADA2a and hADA3 are required for acetylation, transcriptional activity and proliferative effects of beta-catenin. | |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. | |
| 16625196 | 2006 | DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. | |
| 16299514 | 2005 | Structure and chromosomal DNA binding of the SWIRM domain. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12972612 | 2003 | A novel human Ada2 homologue functions with Gcn5 or Brg1 to coactivate transcription. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 9885574 | 1998 | The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily. | |
| 9674425 | 1998 | Histone-like TAFs within the PCAF histone acetylase complex. | |
| 9154805 | 1997 | Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor. | |
| 9073520 | 1997 | The human transcriptional adaptor genes TADA2L and GCN5L2 colocalize to chromosome 17q12-q21 and display a similar tissue expression pattern. | |
| 8972232 | 1997 | Histone acetyltransferase activity is conserved between yeast and human GCN5 and is required for complementation of growth and transcriptional activation. | |
| 8552087 | 1996 | Identification of human proteins functionally conserved with the yeast putative adaptors ADA2 and GCN5. | |
| 8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. |
