Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.73
PubTator Score 79.60

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
26468280 results thus demonstrate that the catalytic activity of GCN5 is stimulated by subunits of the ADA2a- or ADA2b-containing HAT modules and is further increased by incorporation of the distinct HAT modules in the ATAC or SAGA holo-complexes
25492086 Single nucleotide polymorphism in ADA2 gene is associated with type 1 diabetes.
22644376 CCDC134 increased the PCAF-dependent K320 acetylation of p53 and p53 protein stability in the presence of hADA2a overexpression.
20602615 Observational study of gene-disease association. (HuGE Navigator)
18059173 hADA2a and hADA3 as crucial cofactors of beta-catenin that are likely involved in the assembly of transactivation-competent beta-catenin complexes at Wnt target genes.
16299514 The three-dimensional solution structure of the SWIRM domain from the human transcriptional adaptor ADA2alpha was reported.

AA Sequence

MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPV      1 - 70
LDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTA     71 - 140
DTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDI    141 - 210
YHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELR    211 - 280
REIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQADIDSGLSPS    281 - 350
IPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSALLNECNKQGGLRLAQARALI    351 - 420
KIDVNKTRKIYDFLIREGYITKG                                                   421 - 443
//

Text Mined References (24)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26468280 2015 Subunits of ADA-two-A-containing (ATAC) or Spt-Ada-Gcn5-acetyltrasferase (SAGA) Coactivator Complexes Enhance the Acetyltransferase Activity of GCN5.
25492086 2015 Genetic factors adaptive in a malarial environment may increase the risk of type 1 diabetes.
25416956 2014 A proteome-scale map of the human interactome network.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22644376 2012 CCDC134 interacts with hADA2a and functions as a regulator of hADA2a in acetyltransferase activity, DNA damage-induced apoptosis and cell cycle arrest.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
19103755 2009 The double-histone-acetyltransferase complex ATAC is essential for mammalian development.
18059173 2008 hADA2a and hADA3 are required for acetylation, transcriptional activity and proliferative effects of beta-catenin.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16299514 2005 Structure and chromosomal DNA binding of the SWIRM domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972612 2003 A novel human Ada2 homologue functions with Gcn5 or Brg1 to coactivate transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9885574 1998 The 400 kDa subunit of the PCAF histone acetylase complex belongs to the ATM superfamily.
9674425 1998 Histone-like TAFs within the PCAF histone acetylase complex.
9154805 1997 Role of the Ada adaptor complex in gene activation by the glucocorticoid receptor.
9073520 1997 The human transcriptional adaptor genes TADA2L and GCN5L2 colocalize to chromosome 17q12-q21 and display a similar tissue expression pattern.
8972232 1997 Histone acetyltransferase activity is conserved between yeast and human GCN5 and is required for complementation of growth and transcriptional activation.
8552087 1996 Identification of human proteins functionally conserved with the yeast putative adaptors ADA2 and GCN5.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.