Property Summary

Ligand Count 405
NCBI Gene PubMed Count 52
PubMed Score 221.66
PubTator Score 127.21

Knowledge Summary

Patent (16,251)

TINX Plot

  Disease (8)

Disease Target Count
Sjögren's syndrome 5
Disease Target Count P-value
psoriasis 6694 2.8e-10
interstitial cystitis 2312 5.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count Z-score Confidence
Retinitis pigmentosa 67 5 4.133 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.600 5.8e-04
psoriasis 1.700 2.8e-10

 GO Function (1)

 GWAS Trait (1)

Gene RIF (34)

AA Sequence

MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQP      1 - 70
WANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTL     71 - 140
VNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWIL    141 - 210
AFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIP    211 - 280
GDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTM    281 - 350
YNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT    351 - 420
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS                             421 - 465
//

Text Mined References (53)

PMID Year Title