Property Summary

NCBI Gene PubMed Count 59
PubMed Score 87.11
PubTator Score 67.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.400 1.0e-06
glioblastoma 1.800 1.7e-07
osteosarcoma -1.554 3.4e-03
group 3 medulloblastoma 2.400 4.0e-06
atypical teratoid / rhabdoid tumor 2.000 5.5e-08
medulloblastoma, large-cell 2.100 5.9e-05
primitive neuroectodermal tumor 2.000 8.7e-05
Atopic dermatitis 1.200 3.8e-05
adrenocortical carcinoma 1.326 6.2e-04
non-small cell lung cancer 1.306 1.8e-18
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
colon cancer 1.400 6.8e-03
lung cancer 1.300 4.2e-03
interstitial cystitis 1.400 6.5e-04
pediatric high grade glioma 1.500 6.5e-05
Endometriosis 1.626 6.7e-03
Breast cancer 2.200 4.9e-26
invasive ductal carcinoma 1.400 6.4e-04
ovarian cancer 1.200 2.7e-03
psoriasis 1.300 1.3e-82

Gene RIF (37)

PMID Text
26531241 Results showed that high level of TACC3 expression was correlated with advanced clinicopathological classifications, and poor prognosis in non-small cell lung cancer patients indicating that TACC3 is a potential prognostic marker.
26219398 TACC3 is enriched in hepatocellular carcinoma and down-regulation inhibits the proliferation, clonogenicity, and cancer stem cell-like phenotype of HCC cells
26134678 TACC3 depletion in human cell lines causes shorter mitotic spindles. co-immunoprecipitation experiments showed reduced binding between TACC3-F543A and Aurora-A.
26133271 The measurement of TACC3 protein expression may be beneficial for predicting clinical outcomes for gastric cancer patients
25760075 TACC3 is expressed in esophageal squamous cell carcinoma and correlates with poor prognosis
25627682 findings suggest that TACC3 could be recruited as a bridge to cooperatively mediate between the HIF-2alpha PAS-B.ARNT PAS-B complex, thereby participating more directly in HIF-dependent gene transcription than previously anticipated
25613365 TACC3 depletion induces G1 arrest and cell death by activating p38-p53-p21 signaling and triggering a centrosome-mediated cellular stress response.
25535896 our data demonstrated the oncogenic role of FGFR3-TACC3 in vitro, indicating that FGFR3-TACC3 may be useful as a diagnostic marker and therapeutic target in cancers.
25294908 FGFR3-TACC3 rearrangements occur in a subset of patients with lung adenocarcinoma. Such patients should be considered for clinical trials featuring FGFR inhibitors.
25246530 TACC3 is involved in the regulation of microtubule nucleation at the centrosome and functions in the stabilization of the gamma-tubulin ring complex assembly
24769898 findings provide critical information regarding the mechanisms by which TACC3 contributes to genomic instability
24273164 Aurora-A kinase does not regulate TACC3-chTOG complex formation, indicating that Aurora-A solely functions as a recruitment factor for the TACC3-chTOG complex to centrosomes and proximal mitotic spindles.
24077290 TACC3 contributes to spindle formation in proliferating cancer cells.
24003142 Self-assembly and sorting of acentrosomal microtubules by TACC3 facilitate kinetochore capture during the mitotic spindle assembly.
23936413 a novel function for TACC3 in EGF-mediated epithelial-mesenchymal transition in cervical cancer
23887685 TACC3 phosphorylation by Aurora A kinase is required for central spindle assembly.
23787465 [review] TACC3 protein complexes are crucial for proper mitotic spindle assembly and dynamics to prevent faulty cell division and aneuploidy.
23348690 Identify TACC3 as a driver of tumorigenesis as well as an inducer of oncogenic epithelial-mesenchymal transition.
23298836 discovered FGFR3-TACC3 fusions in 4 of 48 glioblastoma samples, but not in any of 43 low-grade glioma samples tested. The fusion, caused by tandem duplication on 4p16.3, led to the loss of the 3'-UTR of FGFR3, blocking gene regulation of miR-99a.
23175443 Identification of a novel oncogenic FGFR3-TACC3 fusion protein in bladder cancer.
22837387 study reports that a small subset of glioblastoma multiforme tumors harbors oncogenic chromosomal translocations that fuse in-frame the tyrosine kinase coding domains of fibroblast growth factor receptor genes(FGFR1 or FGFR3) to the transforming acidic coiled-coil coding domains of TACC1 or TACC3; the FGFR-TACC fusion protein displays oncogenic activity
21815251 we have identified a novel submicroscopic duplication involving dosage sensitive genes TACC3, FGFR3, and LETM1.
21297582 TACC3 recruits ch-TOG and clathrin to the mitotic spindle. Together the complex forms inter-microtubule bridges in kinetochore fibres.
21113414 multifaceted genomic evaluation of glioblastoma establishes ERRFI1 as a potential candidate tumor suppressor gene and TACC3 as a potential oncogene, and provides insight on targets for oncogenic pathway-based therapy
20923838 recruitment to spindle poles by clathrin ensures proper spindle assembly and chromosome alignment in mitotic cells through a RanGTP-dependent pathway
20838383 Data show that ILK performs its centrosome clustering activity in a centrosome-dependent, manner through the microtubule regulating proteins TACC3 and ch-TOG.
20729911 TACC3 controls paclitaxel sensitivity by modulating a premature senescence program.
20566684 the association between aurora A phosphorylation and spindle apparatus; regulation from aurora A is mediated by CHC in recruiting phospho-TACC3 and subsequently ch-TOG to mitotic spindles.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20348956 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20237422 These findings link TACC3 to novel structural and cell division functions of TSC2.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19823035 these findings suggest that Cdh1 controls TACC3 protein stability during mitotic exit.
19148534 overexpression of TACC3 may be associated with the mechanisms of chemoresistance, tumor progression, cell proliferation and metastasis
17914111 Aurora-A and TACC3 interaction is important to control the mitotic spindle organization required for proper chromosome segregation.
17675670 TACC3 has an essential role in spindle assembly and cellular survival
12389629 REVIEW: genetics, expression, gene expression regulation, and function studies

AA Sequence

MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRIL      1 - 70
SPSMASKLEAPFTQDDTLGLENSHPVWTQKENQQLIKEVDAKTTHGILQKPVEADTDLLGDASPAFGSGS     71 - 140
SSESGPGALADLDCSSSSQSPGSSENQMVSPGKVSGSPEQAVEENLSSYSLDRRVTPASETLEDPCRTES    141 - 210
QHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVG    211 - 280
TPVPADGTQTLTCAHTSAPESTAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGATSKR    281 - 350
APPPRRLGERSGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDWDKMDDPNFIPFGG    351 - 420
DTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSASAEDTPVVQLAAETPTAESKERA    421 - 490
LNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRDPAEVLGTGAEVDYLEQFGTSSFKESALRKQSLY    491 - 560
LKFDPLLRDSPGRPVPVATETSSMHGANETPSGRPREAKLVEFDFLGALDIPVPGPPPGVPAPGGPPLST    561 - 630
GPIVDLLQYSQKDLDAVVKATQEENRELRSRCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAE    631 - 700
IQKVLKEKDQLTTDLNSMEKSFSDLFKRFEKQKEVIEGYRKNEESLKKCVEDYLARITQEGQRYQALKAH    701 - 770
AEEKLQLANEEIAQVRSKAQAEALALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI      771 - 838
//

Text Mined References (70)

PMID Year Title
26531241 2016 The clinical significance of transforming acidic coiled-coil protein 3 expression in non-small cell lung cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26219398 2015 TACC3 promotes stemness and is a potential therapeutic target in hepatocellular carcinoma.
26134678 2015 Aurora-A-Dependent Control of TACC3 Influences the Rate of Mitotic Spindle Assembly.
26133271 2015 High expression of transforming acidic coiled coil-containing protein 3 strongly correlates with aggressive characteristics and poor prognosis of gastric cancer.
25760075 2015 High expression of TACC3 in esophageal squamous cell carcinoma correlates with poor prognosis.
25627682 2015 Coiled-coil coactivators play a structural role mediating interactions in hypoxia-inducible factor heterodimerization.
25613365 2015 Suppression of centrosome protein TACC3 induces G1 arrest and cell death through activation of p38-p53-p21 stress signaling pathway.
25596274 2015 TACC3-ch-TOG track the growing tips of microtubules independently of clathrin and Aurora-A phosphorylation.
25535896 2014 Recurrent FGFR3-TACC3 fusion gene in nasopharyngeal carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25294908 2014 Identification of recurrent FGFR3-TACC3 fusion oncogenes from lung adenocarcinoma.
25246530 2014 TACC3 protein regulates microtubule nucleation by affecting ?-tubulin ring complexes.
24769898 2015 TACC3 deregulates the DNA damage response and confers sensitivity to radiation and PARP inhibition.
24273164 2014 The centrosomal adaptor TACC3 and the microtubule polymerase chTOG interact via defined C-terminal subdomains in an Aurora-A kinase-independent manner.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
24077290 2014 A small compound targeting TACC3 revealed its different spatiotemporal contributions for spindle assembly in cancer cells.
24003142 2013 Self-assembly and sorting of acentrosomal microtubules by TACC3 facilitate kinetochore capture during the mitotic spindle assembly.
23936413 2013 TACC3 is essential for EGF-mediated EMT in cervical cancer.
23918938 2013 Coordination of adjacent domains mediates TACC3-ch-TOG-clathrin assembly and mitotic spindle binding.
23887685 2013 Aurora A kinase and its substrate TACC3 are required for central spindle assembly.
23787465 2013 Role of centrosomal adaptor proteins of the TACC family in the regulation of microtubule dynamics during mitotic cell division.
23532825 2013 Specific removal of TACC3-ch-TOG-clathrin at metaphase deregulates kinetochore fiber tension.
23348690 2013 TACC3 promotes epithelial-mesenchymal transition (EMT) through the activation of PI3K/Akt and ERK signaling pathways.
23298836 2013 The tumorigenic FGFR3-TACC3 gene fusion escapes miR-99a regulation in glioblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175443 2013 Oncogenic FGFR3 gene fusions in bladder cancer.
22837387 2012 Transforming fusions of FGFR and TACC genes in human glioblastoma.
21815251 2011 A novel 4p16.3 microduplication distal to WHSC1 and WHSC2 characterized by oligonucleotide array with new phenotypic features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21297582 2011 A TACC3/ch-TOG/clathrin complex stabilises kinetochore fibres by inter-microtubule bridging.
21269460 2011 Initial characterization of the human central proteome.
21113414 2010 Integrated genomic analyses identify ERRFI1 and TACC3 as glioblastoma-targeted genes.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20923838 2010 Clathrin recruits phosphorylated TACC3 to spindle poles for bipolar spindle assembly and chromosome alignment.
20838383 2011 A critical role of integrin-linked kinase, ch-TOG and TACC3 in centrosome clustering in cancer cells.
20729911 2010 The centrosomal protein TACC3 controls paclitaxel sensitivity by modulating a premature senescence program.
20566684 2010 Clathrin heavy chain mediates TACC3 targeting to mitotic spindles to ensure spindle stability.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20348956 2010 A sequence variant at 4p16.3 confers susceptibility to urinary bladder cancer.
20237422 2010 TACC3-TSC2 maintains nuclear envelope structure and controls cell division.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19823035 2009 Cdh1 controls the stability of TACC3.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19148534 2009 Anticancer effects on TACC3 by treatment of paclitaxel in HPV-18 positive cervical carcinoma cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17914111 2007 Transforming acidic coiled-coil 3 and Aurora-A interact in human thyrocytes and their expression is deregulated in thyroid cancer tissues.
17675670 2007 The transforming acidic coiled coil 3 protein is essential for spindle-dependent chromosome alignment and mitotic survival.
17545617 2007 Localization of human TACC3 to mitotic spindles is mediated by phosphorylation on Ser558 by Aurora A: a novel pharmacodynamic method for measuring Aurora A activity.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14767476 2004 The transforming acidic coiled coil proteins interact with nuclear histone acetyltransferases.
12927788 2003 hLodestar/HuF2 interacts with CDC5L and is involved in pre-mRNA splicing.
12711550 2003 TACC3 expression is tightly regulated during early differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12389629 2002 AINT/ERIC/TACC: an expanding family of proteins with C-terminal coiled coil domains.
12015314 2002 Transforming acidic coiled-coil-containing protein 4 interacts with centrosomal AKAP350 and the mitotic spindle apparatus.
11847113 2002 The centrosomal protein TACC3 is essential for hematopoietic stem cell function and genetically interfaces with p53-regulated apoptosis.
11298601 2001 Characterization and localization of expression of an erythropoietin-induced gene, ERIC-1/TACC3, identified in erythroid precursor cells.
11121038 2000 The TACC domain identifies a family of centrosomal proteins that can interact with microtubules.
10366448 1999 The third member of the transforming acidic coiled coil-containing gene family, TACC3, maps in 4p16, close to translocation breakpoints in multiple myeloma, and is upregulated in various cancer cell lines.
8570611 1996 Analysis of differential gene expression by display of 3' end restriction fragments of cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.