Property Summary

NCBI Gene PubMed Count 29
PubMed Score 13.60
PubTator Score 15.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 2.000 6.3e-07
cutaneous lupus erythematosus -1.300 1.4e-02
osteosarcoma 1.088 7.5e-05
glioblastoma -1.200 2.4e-02
medulloblastoma -1.500 6.6e-03
medulloblastoma, large-cell -2.000 1.9e-02
non-small cell lung cancer -1.141 1.4e-11
intraductal papillary-mucinous adenoma (... 2.500 1.1e-04
intraductal papillary-mucinous carcinoma... 2.300 4.4e-04
intraductal papillary-mucinous neoplasm ... 2.100 7.5e-03
lung cancer -2.900 3.2e-04
interstitial cystitis -1.200 1.0e-02
adult high grade glioma -1.200 3.6e-03
posterior fossa group A ependymoma -1.200 3.0e-05
lung adenocarcinoma -1.200 1.6e-05
nasopharyngeal carcinoma -1.200 7.6e-04
Endometriosis -1.576 1.4e-02
spina bifida -1.713 3.6e-02
ovarian cancer 2.000 3.4e-04
pituitary cancer -1.300 2.9e-04
chronic rhinosinusitis -1.223 3.8e-02
dermatomyositis 1.400 2.1e-04

Gene RIF (12)

PMID Text
25884766 Differential expression of the transcripts TACC2 connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
22456197 Data suggest that TACC2 is highly expressed in prostate cancer cells and contributes to cell cycle progression and cell proliferation in androgen-nonresponsive prostate cancer cells; overexpression of TACC2 leads to recurrence of prostate cancer.
22210879 Results revealed 3 genes highly predictive of event-free survival (EFS), beyond age and MLL status: FLT3, IRX2, and TACC2.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335520 TACC2 may mediate an oncogenic effect on breast cancer cells.
19671663 Simian virus 40 large T antigen interacting with TACC2 is involved in stabilizing microtubules in mitosis.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15304323 Centrosomal TACC2 is required for mitotic spindle maintenance.
14767476 GCN5L2 is a TACC2-binding protein.
12620397 Defects in TACC2 expression may affect gene regulation, thus contributing to the pathogenesis of some tumors.

AA Sequence

MGNENSTSDNQRTLSAQTPRSAQPPGNSQNIKRKQQDTPGSPDHRDASSIGSVGLGGFCTASESSASLDP      1 - 70
CLVSPEVTEPRKDPQGARGPEGSLLPSPPPSQEREHPSSSMPFAECPPEGCLASPAAAPEDGPQTQSPRR     71 - 140
EPAPNAPGDIAAAFPAERDSSTPYQEIAAVPSAGRERQPKEEGQKSSFSFSSGIDQSPGMSPVPLREPMK    141 - 210
APLCGEGDQPGGFESQEKEAAGGFPPAESRQGVASVQVTPEAPAAAQQGTESSAVLEKSPLKPMAPIPQD    211 - 280
PAPRASDRERGQGEAPPQYLTDDLEFLRACHLPRSNSGAAPEAEVNAASQESCQQPVGAYLPHAELPWGL    281 - 350
PSPALVPEAGGSGKEALDTIDVQGHPQTGMRGTKPNQVVCVAAGGQPEGGLPVSPEPSLLTPTEEAHPAS    351 - 420
SLASFPAAQIPIAVEEPGSSSRESVSKAGMPVSADAAKEVVDAGLVGLERQVSDLGSKGEHPEGDPGEVP    421 - 490
APSPQERGEHLNTEQSHEVQPGVPPPPLPKEQSHEVQPGAPPPPLPKAPSESARGPPGPTDGAKVHEDST    491 - 560
SPAVAKEGSRSPGDSPGGKEEAPEPPDGGDPGNLQGEDSQAFSSKRDPEVGKDELSKPSSDAESRDHPSS    561 - 630
HSAQPPRKGGAGHTDGPHSQTAEADASGLPHKLGEEDPVLPPVPDGAGEPTVPEGAIWEGSGLQPKCPDT    631 - 700
LQSREGLGRMESFLTLESEKSDFPPTPVAEVAPKAQEGESTLEIRKMGSCDGEGLLTSPDQPRGPACDAS    701 - 770
RQEFHAGVPHPPQGENLAADLGLTALILDQDQQGIPSCPGEGWIRGAASEWPLLSSEKHLQPSQAQPETS    771 - 840
IFDVLKEQAQPPENGKETSPSHPGFKDQGADSSQIHVPVEPQEDNNLPTHGGQEQALGSELQSQLPKGTL    841 - 910
SDTPTSSPTDMVWESSLTEESELSAPTRQKLPALGEKRPEGACGDGQSSRVSPPAADVLKDFSLAGNFSR    911 - 980
KETCCTGQGPNKSQQALADALEEGSQHEEACQRHPGASEAADGCSPLWGLSKREMASGNTGEAPPCQPDS    981 - 1050
VALLDAVPCLPALAPASPGVTPTQDAPETEACDETQEGRQQPVPAPQQKMECWATSDAESPKLLASFPSA   1051 - 1120
GEQGGEAGAAETGGSAGAGDPGKQQAPEKPGEATLSCGLLQTEHCLTSGEEASTSALRESCQAEHPMASC   1121 - 1190
QDALLPARELGGIPRSTMDFSTHQAVPDPKELLLSGPPEVAAPDTPYLHVDSAAQRGAEDSGVKAVSSAD   1191 - 1260
PRAPGESPCPVGEPPLALENAASLKLFAGSLAPLLQPGAAGGEIPAVQASSGSPKARTTEGPVDSMPCLD   1261 - 1330
RMPLLAKGKQATGEEKAATAPGAGAKASGEGMAGDAAGETEGSMERMGEPSQDPKQGTSGGVDTSSEQIA   1331 - 1400
TLTGFPDFREHIAKIFEKPVLGALATPGEKAGAGRSAVGKDLTRPLGPEKLLDGPPGVDVTLLPAPPARL   1401 - 1470
QVEKKQQLAGEAEISHLALQDPASDKLLGPAGLTWERNLPGAGVGKEMAGVPPTLREDERPEGPGAAWPG   1471 - 1540
LEGQAYSQLERSRQELASGLPSPAATQELPVERAAAFQVAPHSHGEEAVAQDRIPSGKQHQETSACDSPH   1541 - 1610
GEDGPGDFAHTGVPGHVPRSTCAPSPQREVLTVPEANSEPWTLDTLGGERRPGVTAGILEMRNALGNQST   1611 - 1680
PAPPTGEVADTPLEPGKVAGAAGEAEGDITLSTAETQACASGDLPEAGTTRTFSVVAGDLVLPGSCQDPA   1681 - 1750
CSDKAPGMEGTAALHGDSPARPQQAKEQPGPERPIPAGDGKVCVSSPPEPDETHDPKLQHLAPEELHTDR   1751 - 1820
ESPRPGPSMLPSVPKKDAPRVMDKVTSDETRGAEGTESSPVADDIIQPAAPADLESPTLAASSYHGDVVG   1821 - 1890
QVSTDLIAQSISPAAAHAGLPPSAAEHIVSPSAPAGDRVEASTPSCPDPAKDLSRSSDSEEAFETPESTT   1891 - 1960
PVKAPPAPPPPPPEVIPEPEVSTQPPPEEPGCGSETVPVPDGPRSDSVEGSPFRPPSHSFSAVFDEDKPI   1961 - 2030
ASSGTYNLDFDNIELVDTFQTLEPRASDAKNQEGKVNTRRKSTDSVPISKSTLSRSLSLQASDFDGASSS   2031 - 2100
GNPEAVALAPDAYSTGSSSASSTLKRTKKPRPPSLKKKQTTKKPTETPPVKETQQEPDEESLVPSGENLA   2101 - 2170
SETKTESAKTEGPSPALLEETPLEPAVGPKAACPLDSESAEGVVPPASGGGRVQNSPPVGRKTLPLTTAP   2171 - 2240
EAGEVTPSDSGGQEDSPAKGLSVRLEFDYSEDKSSWDNQQENPPPTKKIGKKPVAKMPLRRPKMKKTPEK   2241 - 2310
LDNTPASPPRSPAEPNDIPIAKGTYTFDIDKWDDPNFNPFSSTSKMQESPKLPQQSYNFDPDTCDESVDP   2311 - 2380
FKTSSKTPSSPSKSPASFEIPASAMEANGVDGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDP   2381 - 2450
TPAATPETPPVISAVVHATDEEKLAVTNQKWTCMTVDLEADKQDYPQPSDLSTFVNETKFSSPTEELDYR   2451 - 2520
NSYEIEYMEKIGSSLPQDDDAPKKQALYLMFDTSQESPVKSSPVRMSESPTPCSGSSFEETEALVNTAAK   2521 - 2590
NQHPVPRGLAPNQESHLQVPEKSSQKELEAMGLGTPSEAIEITAPEGSFASADALLSRLAHPVSLCGALD   2591 - 2660
YLEPDLAEKNPPLFAQKLQEELEFAIMRIEALKLARQIALASRSHQDAKREAAHPTDVSISKTALYSRIG   2661 - 2730
TAEVEKPAGLLFQQPDLDSALQIARAEIITKEREVSEWKDKYEESRREVMEMRKIVAEYEKTIAQMIEDE   2731 - 2800
QREKSVSHQTVQQLVLEKEQALADLNSVEKSLADLFRRYEKMKEVLEGFRKNEEVLKRCAQEYLSRVKKE   2801 - 2870
EQRYQALKVHAEEKLDRANAEIAQVRGKAQQEQAAHQASLRKEQLRVDALERTLEQKNKEIEELTKICDE   2871 - 2940
LIAKMGKS                                                                 2941 - 2948
//

Text Mined References (38)

PMID Year Title
25884766 2015 Epigenetic regulation of lncRNA connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22456197 2012 TACC2 is an androgen-responsive cell cycle regulator promoting androgen-mediated and castration-resistant growth of prostate cancer.
22210879 2012 Gene expression profiles predictive of outcome and age in infant acute lymphoblastic leukemia: a Children's Oncology Group study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20335520 Transforming acidic coiled-coil-containing protein 2 (TACC2) in human breast cancer, expression pattern and clinical/prognostic relevance.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19671663 2009 Simian virus 40 large T antigen targets the microtubule-stabilizing protein TACC2.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304323 2004 TTK kinase is essential for the centrosomal localization of TACC2.
15207008 2004 Structure-function evolution of the transforming acidic coiled coil genes revealed by analysis of phylogenetically diverse organisms.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14767476 2004 The transforming acidic coiled coil proteins interact with nuclear histone acetyltransferases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12711550 2003 TACC3 expression is tightly regulated during early differentiation.
12620397 2003 Molecular cloning, genomic structure and interactions of the putative breast tumor suppressor TACC2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11161455 2001 Cloning and structural characterization of ECTACC, a new member of the transforming acidic coiled coil (TACC) gene family: cDNA sequence and expression analysis in human microvascular endothelial cells.
11121038 2000 The TACC domain identifies a family of centrosomal proteins that can interact with microtubules.
10749935 2000 AZU-1: a candidate breast tumor suppressor and biomarker for tumor progression.
10637228 2000 D-TACC: a novel centrosomal protein required for normal spindle function in the early Drosophila embryo.
10435627 1999 Cloning of TACC1, an embryonically expressed, potentially transforming coiled coil containing gene, from the 8p11 breast cancer amplicon.
10366448 1999 The third member of the transforming acidic coiled coil-containing gene family, TACC3, maps in 4p16, close to translocation breakpoints in multiple myeloma, and is upregulated in various cancer cell lines.