Property Summary

NCBI Gene PubMed Count 35
PubMed Score 17.99
PubTator Score 18.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 2.400 6.9e-06
Multiple myeloma 1.213 6.0e-03
psoriasis -1.500 7.5e-07
osteosarcoma -2.144 1.1e-05
ependymoma -1.400 2.0e-05
glioblastoma -1.400 1.2e-02
medulloblastoma -2.700 3.5e-07
atypical teratoid / rhabdoid tumor -2.700 1.2e-06
medulloblastoma, large-cell -3.500 8.3e-07
primitive neuroectodermal tumor -1.600 2.9e-03
Duchenne muscular dystrophy 1.160 2.2e-05
autosomal dominant Emery-Dreifuss muscul... 1.050 2.4e-02
tuberculosis and treatment for 6 months 1.200 1.7e-05
non-small cell lung cancer -1.340 2.1e-14
intraductal papillary-mucinous adenoma (... -1.600 3.9e-03
lung cancer -3.600 4.0e-05
colon cancer -1.100 5.5e-03
breast carcinoma -1.500 5.5e-05
fibroadenoma -1.300 2.8e-02
lung adenocarcinoma -2.000 2.5e-22
adult high grade glioma -1.800 1.7e-03
lung carcinoma -1.100 1.4e-17
Pick disease 1.500 1.5e-06
ductal carcinoma in situ -1.800 4.2e-04
invasive ductal carcinoma -2.100 4.1e-04
ovarian cancer -3.600 2.6e-09
dermatomyositis 1.300 5.6e-03

Gene RIF (15)

PMID Text
25297519 The correlation between TACC1 expression and HER-2-positive status indicates synergistic regulation of these two prognostic markers in gastric carcinoma patients.
24358147 TFF3 and TACC1 over-expression in epithelial cells of surgically resected gastric cancer tissues was an independent predictor of short survival in gastric cancer patients.
23354013 These findings provide proof and the foundation for the molecular and biological relationships of ErbB-2 and TACC1 in breast cancer.
22837387 study reports that a small subset of glioblastoma multiforme tumors harbors oncogenic chromosomal translocations that fuse in-frame the tyrosine kinase coding domains of fibroblast growth factor receptor genes(FGFR1 or FGFR3) to the transforming acidic coiled-coil coding domains of TACC1 or TACC3; the FGFR-TACC fusion protein displays oncogenic activity
21531210 the study demonstrated that TACC1 localizes at the midbody during cytokinesis and interacts with and is a substrate of Aurora-C, which warrant further investigation in order to elucidate the functional significance of this interaction.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20508983 Observational study of gene-disease association. (HuGE Navigator)
20078863 TACC1 depletion in the cell led to decreased RARalpha and TRalpha ligand-dependent transcriptional activity and to delocalization of TR from the nucleus to the cytoplasm.
18984771 TACC1 and a three-gene expression signature (TACC1, NOV, and PTTG1) were identified as independent prognostic markers.
16496324 Splice variants can be localized to different subcellular compartments in a cell-and tissue-specific manner.
15064709 TACC1 and the mitotic kinase Aurora B belong to the same complex during cytokinesis.
12547166 Splicing pattern of its mRNA is altered in stomach cancer
12389629 REVIEW: genetics, expression, gene expression regulation, and function studies
12165861 Down regulation of tacc1 controls mrna homeostasis in polarized cells and participates in oncogenic processes in human cancers
11903063 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells

AA Sequence

MAFSPWQILSPVQWAKWTWSAVRGGAAGEDEAGGPEGDPEEEDSQAETKSLSFSSDSEGNFETPEAETPI      1 - 70
RSPFKESCDPSLGLAGPGAKSQESQEADEQLVAEVVEKCSSKTCSKPSENEVPQQAIDSHSVKNFREEPE     71 - 140
HDFSKISIVRPFSIETKDSTDISAVLGTKAAHGCVTAVSGKALPSSPPDALQDEAMTEGSMGVTLEASAE    141 - 210
ADLKAGNSCPELVPSRRSKLRKPKPVPLRKKAIGGEFSDTNAAVEGTPLPKASYHFSPEELDENTSPLLG    211 - 280
DARFQKSPPDLKETPGTLSSDTNDSGVELGEESRSSPLKLEFDFTEDTGNIEARKALPRKLGRKLGSTLT    281 - 350
PKIQKDGISKSAGLEQPTDPVARDGPLSQTSSKPDPSQWESPSFNPFGSHSVLQNSPPLSSEGSYHFDPD    351 - 420
NFDESMDPFKPTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVI    421 - 490
SQISDISNRDGHATDEEKLASTSCGQKSAGAEVKGEPEEDLEYFECSNVPVSTINHAFSSSEAGIEKETC    491 - 560
QKMEEDGSTVLGLLESSAEKAPVSVSCGGESPLDGICLSESDKTAVLTLIREEIITKEIEANEWKKKYEE    561 - 630
TRQEVLEMRKIVAEYEKTIAQMIEDEQRTSMTSQKSFQQLTMEKEQALADLNSVERSLSDLFRRYENLKG    631 - 700
VLEGFKKNEEALKKCAQDYLARVKQEEQRYQALKIHAEEKLDKANEEIAQVRTKAKAESAALHAGLRKEQ    701 - 770
MKVESLERALQQKNQEIEELTKICDELIAKLGKTD                                       771 - 805
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25416956 2014 A proteome-scale map of the human interactome network.
25297519 2014 Prognosis significance of HER2 status and TACC1 expression in patients with gastric carcinoma.
24358147 2013 Impact of NPM, TFF3 and TACC1 on the prognosis of patients with primary gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23354013 2013 Efficient downregulation of ErbB-2 induces TACC1 upregulation in breast cancer cell lines.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22837387 2012 Transforming fusions of FGFR and TACC genes in human glioblastoma.
21531210 2011 Aurora-C interacts with and phosphorylates the transforming acidic coiled-coil 1 protein.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20078863 2010 The transforming acidic coiled coil (TACC1) protein modulates the transcriptional activity of the nuclear receptors TR and RAR.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18984771 2009 Identification of TACC1, NOV, and PTTG1 as new candidate genes associated with endocrine therapy resistance in breast cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16496324 2006 Temporal and spatial expression of TACC1 in the mouse and human.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15207008 2004 Structure-function evolution of the transforming acidic coiled coil genes revealed by analysis of phylogenetically diverse organisms.
15064709 2004 Aurora B -TACC1 protein complex in cytokinesis.
14767476 2004 The transforming acidic coiled coil proteins interact with nuclear histone acetyltransferases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14603251 2003 TACC1-chTOG-Aurora A protein complex in breast cancer.
12547166 2002 Altered splicing pattern of TACC1 mRNA in gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12389629 2002 AINT/ERIC/TACC: an expanding family of proteins with C-terminal coiled coil domains.
12165861 2002 Carcinogenesis and translational controls: TACC1 is down-regulated in human cancers and associates with mRNA regulators.
12087473 2002 Serological identification and expression analysis of gastric cancer-associated genes.
11903063 2002 Interaction of the transforming acidic coiled-coil 1 (TACC1) protein with ch-TOG and GAS41/NuBI1 suggests multiple TACC1-containing protein complexes in human cells.
11121038 2000 The TACC domain identifies a family of centrosomal proteins that can interact with microtubules.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10435627 1999 Cloning of TACC1, an embryonically expressed, potentially transforming coiled coil containing gene, from the 8p11 breast cancer amplicon.
10366448 1999 The third member of the transforming acidic coiled coil-containing gene family, TACC3, maps in 4p16, close to translocation breakpoints in multiple myeloma, and is upregulated in various cancer cell lines.