Property Summary

NCBI Gene PubMed Count 16
PubMed Score 35.78
PubTator Score 17.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03
adult high grade glioma 2148 8.1e-03
Disease Target Count Z-score Confidence
Shipyard eye 14 5.607 2.8

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.500 1.1e-03
adult high grade glioma -1.100 8.1e-03

Gene RIF (9)

PMID Text
22554585 HKs emerge as pivotal endogenous regulators of angiogenesis through neurokinin-1 receptor
21368235 HK-1 and substance P are novel T helper (Th)17 cell-inducing factors that may act locally on memory T cells to amplify inflammatory responses.
21342363 Data provide evidence for the first time that hemokinin-1, like substance P, may be involved in the pathophysiology of inflammatory bowel disease.
21168392 hHK-1 and its C-terminal fragments are human NK1 receptor agonists with different functional selectivity properties and that such functional selectivity leads to differential activation of downstream signaling and receptor trafficking.
20929541 Endogenous expression of hemokinin-1 is demonstrated in bronchi and is involved in contraction of airway explants.
20580442 A possible association is found between a tachykinin-4 single nucleotide polymorphism and susceptibility to asthma.
20580442 Observational study of gene-disease association. (HuGE Navigator)
19081134 Results suggest that Hemokinin-1 is regulated by a unique transcription regulation system that likely governs its differential expression pattern and suggests a role for Hemokinin-1 distinct from Substance P.
17175032 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKR      1 - 70
VGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE                                71 - 113
//

Text Mined References (21)

PMID Year Title
22554585 2012 Hemokinins modulate endothelium function and promote angiogenesis through neurokinin-1 receptor.
21368235 2011 The tachykinins substance P and hemokinin-1 favor the generation of human memory Th17 cells by inducing IL-1?, IL-23, and TNF-like 1A expression by monocytes.
21342363 2011 Distinct differences in tachykinin gene expression in ulcerative colitis, Crohn's disease and diverticular disease: a role for hemokinin-1?
21168392 2011 The N-terminal domain of human hemokinin-1 influences functional selectivity property for tachykinin receptor neurokinin-1.
20929541 2010 Expression and function of human hemokinin-1 in human and guinea pig airways.
20580442 2010 Common variants of the neuropeptide expressing tachykinin genes and susceptibility to asthma: a case-control study.
19081134 2009 Regulatory mechanisms in the differential expression of Hemokinin-1.
17655832 2007 Leucine at the carboxyl-terminal of endokinins C and D contributes to elicitation of the antagonistic effect on substance P in rat pain processing.
17437961 2007 A role for tachykinins in the regulation of human sperm motility.
17175032 2007 The neuropeptide genes TAC1, TAC3, TAC4, VIP and PACAP(ADCYAP1), and susceptibility to multiple sclerosis.
17101218 2006 Intrathecal administration of the common carboxyl-terminal decapeptide in endokinin A and endokinin B evokes scratching behavior and thermal hyperalgesia in the rat.
16931167 2006 Characterization of the gene structures, precursor processing and pharmacology of the endokinin peptides.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15224188 2004 Hemokinins and endokinins.
12788812 2003 Tachykinins and tachykinin receptors in human uterus.
12716968 2003 Characterization of the endokinins: human tachykinins with cardiovascular activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383518 2002 Identification, localization and receptor characterization of novel mammalian substance P-like peptides.
11786503 2002 Pharmacological profile of the novel mammalian tachykinin, hemokinin 1.
11062498 2000 Hemokinin is a hematopoietic-specific tachykinin that regulates B lymphopoiesis.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.