Property Summary

NCBI Gene PubMed Count 179
PubMed Score 13651.73
PubTator Score 4666.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Globe disease 57 0.0 1.0
colon cancer 1475 0.0 1.0

Expression

  Differential Expression (20)

Disease log2 FC p
posterior fossa group B ependymoma -5.500 5.2e-17
oligodendroglioma -3.500 5.9e-14
astrocytoma -3.400 6.3e-05
glioblastoma -5.100 1.6e-05
atypical teratoid / rhabdoid tumor -4.200 2.5e-05
adrenocortical carcinoma -2.044 1.3e-07
intraductal papillary-mucinous adenoma (... -1.100 4.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.4e-02
colon cancer -2.000 5.9e-04
Parkinson's disease -1.700 1.9e-02
interstitial cystitis -1.900 2.9e-02
pediatric high grade glioma -4.200 1.8e-04
pilocytic astrocytoma -5.400 2.1e-09
sonic hedgehog group medulloblastoma -4.100 6.8e-04
invasive ductal carcinoma -3.773 4.9e-05
Pick disease -1.400 1.9e-02
pituitary cancer -1.300 5.1e-04
Down syndrome -1.200 1.8e-02
psoriasis -2.000 3.7e-32
facioscapulohumeral dystrophy 3.500 1.6e-07

 GO Function (1)

Gene RIF (146)

PMID Text
26852662 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/beta-arrestin 2/Rho A signaling pathway.
26349209 The spatial structures of human, mouse, and rat hemokinin-1 protein isoforms have been presented.
26038607 Circulating Neurokinin A >/= 50 ng/L is a strong indicator of poor prognosis when Neurokinin A remains above this concentration
25783846 Report absence of full-length neurokinin-1 receptor protein expression by cutaneous T cells in mycosis fungoides and discuss substance P signaling.
25750171 High TAC1 expression is associated with breast cancer.
25690155 findings suggest a proinflammatory role for SP in autoimmune inflammation
25135735 The results showed that the expression of SP and CGRP was significantly enhanced in the neurogenic SMSCs in response to IL-1beta, IL-6 and TNF-alpha, and the effect was remarkably inhibited by HA.
24969128 Decrease of mGluR5 receptor density goes parallel with changes in enkephalin and substance P immunoreactivity in Huntington's disease
24908181 Substance P was significantly increased in hypertrophic scars compared with matched unburned skin. In the reticular dermis and papillary dermis, SP represented significant correlation with pain.
24844859 Substance P is upregulated in the serum of patients with chronic spontaneous urticaria
24603459 Overexpression of membrane metalloendopeptidase inhibits substance P stimulation of cholangiocarcinoma growth.
24577568 SP induces higher levels of CD163 in monocytes and that high expression of CD163 is associated with increases HIV infection in macrophages.
24563019 An increased presence of Substance P in the trochanteric bursa may be related to the pain associated with greater trochanteric pain syndrome.
24486589 we define a three-gene panel, CDO1, HOXA9, and TAC1, which we subsequently validate in two independent cohorts of primary NSCLC samples
24374326 study investigated the role of SP in promoting the development of brain tumors; an increase in the levels of SP was noted in brain tumors; results suggest that SP and its NK1 receptor may play a major role in the progression of certain types of brain tumors
24286592 Substance P may be protective acutely following ischemia-reperfusion, but damaging long-term in non-ischemic induced remodeling and heart failure.
24084156 Copper(II) complexes of neuropeptide gamma with point mutations (S8,16A) products of metal-catalyzed oxidation.
24010162 TRH, LH-RH and substance P are not affected in Alzheimer disease and Down's syndrome.
23995243 Substance P does not play any important role in pruritus in hemodialysed and peritoneal dialyzed patients.
23977290 SP may influence the KP and NKB secretory output via additional autocrine/paracrine mechanisms or regulate GnRH neurosecretion directly.
23873242 Data indicate that both nucleus pulposus (NP) and annulus fibrosus (AF) cells expressed Substance P (SP) at low levels.
23862763 Serum methylation levels of TAC1, SEPT9, and EYA4 were significant discriminants between stage I colorectal cancer and healthy controls.
23827863 TAC1 expression level was differentially altered in Crohn disease and ulcerative colitis patients.
23737731 The results showed that SP is present in the gengival sulcus in elements undergoing orthodontic forces during treatment with Invisalign technique and not in the control teeth.
23420374 CpG hypermethylation is a likely mechanism of TAC1 and TACR1 gene inactivation, supporting the hypothesis that TAC1 and TACR1 play a role in the tumorigenesis of HNSCC and that this hypermethylation may serve as an important biomarker.
23345604 Our results suggest that Substance P plays an important role in the development of pancreatic cancer metastasis and PNI, and blocking the SP/NK-1R signaling system is a novel strategy for the treatment of pancreatic cancer.
23257919 SP stimulates complement C3 secretion in adipocytes, and expression of NK1R in human omental adipose tissue correlates with plasma complement C3.
22961239 Expression of esophageal epithelial CGRP and substance P is increased, and correlates negatively with perception thresholds in non-erosive reflux disease.
22906243 Data indicate that circulating substance P (SP) and TGF-beta1 levels are increased in patients with myelofibrosis.
22836729 This study indicates that SP, mediated via NK-1 R, increases collagen remodeling and leads to increased MMP3 mRNA and protein expression that is further enhanced by cyclic mechanical loading.
22733436 This study aims to explore the associations of polymorphisms in tachykinin, precursor 1 (TAC1), tachykinin receptor 1 (TACR1), and tachykinin receptor 2 (TACR2) genes and their interactions with the risk of colorectal cancer among Chinese population.
22681041 Elevated substance P levels might be regarded as an important contributor of sulfur mustard-induced chronic pruritus and a potential target for reducing the symptoms
22572771 Tissue and serum levels of substance P were increased in chronic pancreatitis, while neprilysin levels remained unaltered.
22449753 These data suggest a direct relationship between central nervous system substance P containing neural circuits and aggression in human subjects
22429353 CGRP and SP may have a role in the pathogenesis of coronary artery disease in patients with diabetes.
22392530 Human progenitor cells (PC) express NK1, and substance p-induced migration provides enrichment for proangiogenic PC
22354721 The unique co-existence of SP and phospho-NMDAR1 in tendinopathy presumably reflects a tissue proliferative and nociceptive role.
22189180 Data show that serum neurokinin A levels are elevated in some autistic children and are significantly correlated to the severity of autism and to serum levels of anti-ribosomal P protein antibodies.
22115773 Substance P upregulates monocyte tissue factor (TF), the major coagulation cascade stimulator, in a concentration and time dependent manner.
22057425 the importance of p31(comet) in checkpoint silencing and its potential as a target for antimitotic therapies.
21926539 Report validation of neurokinin A biomarker assays across continents.
21671725 TAC1 has a key role in developmental regulation of mesenchymal stem cells differentiation into neurons.
21550738 elevated MMP-9, reduced SP, and normal CGRP levels were characteristic of the blood biomarker profiles of alternating hemiplegia of childhood patients
21375557 Our data suggests that substance P induces NK92-MI cell cytotoxicity by directly increasing the expression of cytotoxic granules and indirectly upregulates the receptor-mediated functions of NK92-MI cells.
21368235 Substance P and hemokinin-1 are novel T helper (Th)17 cell-inducing factors that may act locally on memory T cells to amplify inflammatory responses.
21167238 Substance P and VIP neurofibers are present in the fibroid pseudocapsule of uterine fibroids, similar to the values in the normal myometrium of a non-pregnant uterus.
21160161 The promoter of the TAC1 transgene must act in synergy with a remote enhancer in order to respond to MAP kinase signalling that modulates the expression of TAC1 in sensory neurones.
21107196 These findings suggest that SP contributes to the pain and inflammation associated with carpal tunnel syndrome.
21091716 The substance P-neurokinin-1 receptor system is reviewed in relationship to their immune system functions and selected infections.
21076839 fibroblastic CD10 expression may down-regulate skin inflammation by degrading SP or reducing its level in the dermal microenvironment
20940324 Truncated and full-length NK1R isoforms are expressed in and SP bound by ex vivo NK cells and the YTS NK cell line.
20861424 Bupivacaine wound infusion resulted in a significant decrease of interleukin 10 and increase of substance P in wounds after cesarean section.
20692311 The SP amount was higher in the post-cesarean section scar than in lower uterine fibers in first cesarean section.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20580442 In this study, although significant association with asthma is observed for the single nucleotide polymorphisms of the TAC3 and TAC4 genes, no association with asthma pathogenesis is found for TAC1.
20529207 Data show that 1/3 of pediatric slow-transit constipation patients have low substance P or vasoactive intestinal peptide nerve fiber density in proximal colon.
20526012 In cholestasis, there is increased availability of substance P which may mediate the development of pruritus.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20497485 Substance P primes TLR2-mediated activation of human mast cells by up-regulating TLR expression and potentiating signalling pathways associated with TLR.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20417061 Similar to the situation in prurigo nodularus, chronic pruritus lesions also demonstrate a preponderance of SP+ sensory nerve fibers relative to sympathetic nerve fibers, which probably acts as a causal pro-inflammatory signal in development of pruritus
20405330 neuropeptide S precursor gene.
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20207019 indicate alterations of the cerebral PENK A- and PTA-system in both, dementia and acute neuroinflammatory disorders
20173430 Observational study of gene-disease association. (HuGE Navigator)
20160043 cigarette smoke amplifies the LPS-induced macrophages' secretion of IL-1beta and TNF-alpha through synergizing SP secretion, which activates NF-kappaB via binding with NK1R
20029189 Nicergoline increases substance P levels in ischaemic stroke patients with partial damage to basal ganglia, who have a decreased swallowing response and consequent risk of aspiration pneumonia.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19909213 Our results have demonstrated, for the first time, a positive impact for Substance P and CGRP as expansion factors for the growth of cord blood CD34+ hematopoietic stem cells.
19885583 Substance P and NK-1R are expressed in oral precancerous epithelium
19874574 Observational study of gene-disease association. (HuGE Navigator)
19855234 Studies indicate that CgA, pancreastatin and neurokinin A have strong prognostic value.
19812951 This study suggested that is present in perivascular axon of cerebral microvasculature, is released early following injury and is markedly upregulated in pyramidal cortical neuron.
19695094 nerve growth factor was significantly correlated with both MMP-10 and substance P mRNA in surgical degenerate nucleus pulposus samples
19685709 The SP level of the nasal septum in the perennial allergic rhinitis patients was higher than that in the normal controls.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19381016 Substance P stimulates human airway submucosal gland secretion mainly via a CFTR-dependent process.
19279355 Substance P can directly modulate the release of TGF-beta from human bronchial epithelial cell lines and thereby participates in various lung functions or pathologic conditions.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19246391 REST knockdown in low-metastatic cells and nontumorigenic cells resulted in increases in TAC1 induction, proliferation, and migration
19207952 These findings suggest that SP could modulate the growth of human laryngeal cancer cells and the possibility of treatment with antagonists of NK1R.
19200949 NK(1) receptor binding in patients (n = 14) compared with that in healthy subjects (n = 14) was significantly decreased by 12% to 21% in all brain regions
19086053 Observational study of gene-disease association. (HuGE Navigator)
19046942 Evidence presented strongly supporting a role for the neuroendocrine peptide gene TAC1 as a target of aberrant epigenetic silencing in gastric cancer.
19036058 Actions of the SP/NK-1R complex may contribute to the immune disorder underlying oral lichen planus and trigger stimuli to induce cell proliferation.
18990442 The change in expression of sNRSF and TAC1 mRNA following mechanical stimulation in osteoarthritic (OA) but not normal chondrocytes suggests that sNRSF may be involved in the regulation of substance P production in OA cartilage.
18941231 Cannabinoid inhibits HIV-1 gp120-induced calcium influx mediated by substance P in human brain micro vascular endothelial cells (HBMEC)
18615578 Pregabalin and gabapentin decreased substance P-induced NF-kappaB activation in human neuroblastoma and rat glioma cells
18599605 SP mediates angiogenesis via CCN1 during colitis.
18507649 Sputum NKA is up-regulated during acute asthma exacerbation and it positively correlates to its severity.
18363037 substance-P promotes platelet-dependent clot formation through NK1R, in which leukocytes appear to be involved.
18316470 Tac1 is relevant to breast cancer metastasis, to bone marrow where stromal cells have a significant facilitating function.
18289674 both SP and bombesin is be present in synovial tissue extracts and synovial levels of SP were higher in rheumatoid arthritis patients than those with osteoarthritis
18211417 Substance P plasma level in atopic dermatitis patients during exacerbation and remission was significantly higher than in the control group.
18197882 Specific changes in CGRP and substance P at different levels of the central nervous system in the different models of pain (formalin test and nitroglycerin administration).
18179473 In gingival fibroblast cells induced up-regulation of MMP-1, -3, -11 and TIMP-2 expression
18061399 The broad categories of cytokines as hematopoietic stimulators or inhibitors might depend on the avidity of RNA-binding protein(s) for Tac1 mRNA, as well as the ability to degrade or stabilize the specific miRNAs
17975140 TAC1 promoter hypermethylation is a common event in human esophageal carcinoma
17949241 Report modulation of substance P signaling by dipeptidyl peptidase-IV enzymatic activity in human glioma cell lines.
17940602 there are two proposed mechanisms for severe hRSV disease: reduced local IFN-gamma response and SP mediated inflammation
17855557 neurotransmitter substance P is regulated by microRNAs in human mesenchymal stem cell-derived neuronal cells
17709376 there is synergism between REST and NFkappaB in the suppression of TAC1 in non-neuronal cells
17703412 Observational study of gene-disease association. (HuGE Navigator)
17667845 Substance P was elevated in obstructive sleep apnea.
17655760 Observational study of gene-disease association. (HuGE Navigator)
17588657 These findings suggest the novel possible role of SP in blasts proliferation in childhood ALL of common (CD10) origin.
17494790 We concluded that excessive daytime sleepiness seen in some of the obstructive sleep apnea syndrome patients might be associated with various pathophysiologic mechanisms including substance P levels.
17450584 Substance P and Titanium particles acted synergistically to increase PGE2 and IL-6 secretion in fibroblasts from periprosthetic membrane.
17448763 Observational study of gene-disease association. (HuGE Navigator)
17409218 NF-kappaB is involved in the repression of Tac1 at higher levels of SDF-1alpha in MCF12A. These results are relevant to dysfunction of Tac1 in breast cancer cells.
17376622 the TAC1 locus is not likely to play a major role in the development of autism.
17370082 Nonneuronal substance P and its receptor NK-1 might have a role in psoriasis, also during chronic stress.
17264209 Possesses antiapoptotic effects in the colonic mucosa by activating Akt, which prevents apoptosis and mediates tissue recovery during colitis.
17257983 Increase in AngII and decrease in substance P after coronary artery bypass grafting may play role in occurrence of postoperative atrial fibrillation.
17175032 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17087112 SP, CGRP and VIP may play important roles in the pathophysiological mechanism of vasomotor rhinitis.
16952549 SST and TAC1 are involved in colon carcinogenesis.
16877367 Activation of STAT6 appears to be a key factor in P-selectin expression induced by substance P and IL-4 because treatment with STAT6 decoy oligodeoxynucleotides significantly inhibited P-selectin expression.
16816831 The increase in plasma SP concentrations, possibly driven by serum progesterone concentration, is certainly an important element of the hypothalamo-pituitary-gonadal system necessary for the full development of the preovulatory LH surge in the human.
15899028 Bombesin/gastrin-releasing peptide and substance P are involved together with cytokines in the neuroimmunomodulation that occurs in the arthritic joint.
15761654 Prresence in pituitary tumours is unknown but does not appear to be related to headache or endocrine activity of the tumour.
15729363 Observational study of gene-disease association. (HuGE Navigator)
15690122 Preprotachykinin-I peptides mediate autocrine proliferation of the neuroblastoma cells through both NK-1 and NK-2 receptors.
15544859 data directly demonstrate the presence of both PPT-A mRNA and tachykinin immunoreactivity in inflammatory airway cells which are in direct contact to NK-1 receptor positive glandular myoepithelium
15358539 certain bioactive peptides such as somatostatin and substance P directly interact with human P-glycoprotein as endogenous substrates for P-glycoprotein-mediated transport
15130944 SP stimulates platelet aggregation, intracellular mobilization of calcium and degranulation. Platelets contain SP-like immunoreactivity that is secreted upon activation implicating SP-like substances in the autocrine/paracrine regulation of these cells.
14749007 The contents of plasma neurokinin A (NKA) were significantly higher during the asthma attack stage of children, and the higher was the level of NKA, the more severe the attack.
14703707 Normal component of human tears. Levels might reflect denervation of eye surface. Catabolized by degradative enzymes in tears to maintain ocular surface by exerting trophic effects of substance P while avoiding undesirable effects.
14589248 Presence of substance P within these nerves is strong evidence that these nerves have the potential to transmit signals of nociception.
14564346 Elevated substance P in nasal lavage fluid associated with increased cough sensitivity in patients with chronic nonproductive cough. Neurochemical abnormality in upper airway.
14532289 substance P receptor dimerization with micro-opioid receptor, sequestering MOR-1 via an endocytotic pathway with delayed recycling and resensitization kinetics.
12871824 This review points out a distinct role for full-length peptide substance P by reducing excessive excitation in the activity-dependent modulation of cholinergic neurotransmission.
12854086 correlation between SP levels and diarrhea severity in cryptosporidiosis; may imply that SP plays a role in diarrhea mediation
12705477 Expression of substance P was studied in neoplastic cells of childhood acute lymphocytic leukemia. It was detected in the cytoplasm of blasts in leukemias of the common and T-lymphocyte cell types.
12686752 a role for substance P and its receptor, neurokinin NK(1) receptor, in the brainstem nuclei in the development of emesis (review)
12578734 The release of substance P is higher during the first 12 hours after a cerebral ischemia attack, decreasing later but remaining high compared to controls.
12548712 Substance P expressed in NT2-N neuronal cells is functionally involved in the regulation of macrophage inflammatory protein 1 beta and may play a major role in modulating neuronal functions related to immune regulatory activities within the CNS.
12528114 Substance P is expressed in human articular cartilage and is involved in chondrocyte mechanotransduction via the NK1 receptor in an autocrine and paracrine manner.
12486316 REVIEW: Substance p-fibronectin-cytokine interactions in myeloproliferative disorders with bone marrow fibrosis.
12383866 Substance P induced intracellular signalling in Caco-2 cells. It induced the activation of the mitogen-activated protein kinases in a time- and dose-dependent manner.
12382579 Substance P up-regulates the TGF-beta 1 mRNA expression of human dermal fibroblasts in vitro
12074933 The antimicrobial peptide substance P has activity against invasive bacteria and fungi.
11950831 Involvement of the second extracellular loop (E2) of the neurokinin-1 receptor in the binding of substance P
11921119 We report on an HD phenocopy with selective loss of preprotachykinin (PPT) neurons, dysfunction of surviving PPT neurons, preservation of preproenkephalin (PPE) neurons within the striatum.
11919172 Cannabinoid inhibits HIV-1 gp120-induced calcium influx mediated by substance P in human brain micro vascular endothelial cells (HBMEC)

AA Sequence

MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGK      1 - 70
RDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR                71 - 129
//

Text Mined References (181)

PMID Year Title
26852662 2016 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/?-arrestin 2/Rho A signaling pathway.
26349209 [Particularities of Spatial Organization of Human Hemokinin-1 and Mouse/Rat Hemokinin-1 Molecules].
26038607 2016 Raised circulating Neurokinin A predicts prognosis in metastatic small bowel neuroendocrine tumours. Lowering Neurokinin A indicates improved prognosis.
25783846 2015 Absence of full-length neurokinin-1 receptor protein expression by cutaneous T cells: implications for substance P-mediated signaling in mycosis fungoides.
25750171 2015 APRIL promotes breast tumor growth and metastasis and is associated with aggressive basal breast cancer.
25690155 2015 Reciprocal Regulation of Substance P and IL-12/IL-23 and the Associated Cytokines, IFN?/IL-17: A Perspective on the Relevance of This Interaction to Multiple Sclerosis.
25135735 2014 Mutual effect between neuropeptides and inflammatory cytokines in neurogenic SMSCs of human temporomandibular joint.
24969128 2015 Decrease of mGluR5 receptor density goes parallel with changes in enkephalin and substance P immunoreactivity in Huntington's disease: a preliminary investigation in the postmortem human brain.
24908181 2014 Immunohistochemical analysis of neuropeptides (protein gene product 9.5, substance P and calcitonin gene-related peptide) in hypertrophic burn scar with pain and itching.
24844859 2014 Substance P is upregulated in the serum of patients with chronic spontaneous urticaria.
24660773 2014 Substance P at the neuro-immune crosstalk in the modulation of inflammation, asthma and antimicrobial host defense.
24603459 2014 Overexpression of membrane metalloendopeptidase inhibits substance P stimulation of cholangiocarcinoma growth.
24577568 2014 HIV infection of macrophages is enhanced in the presence of increased expression of CD163 induced by substance P.
24563019 2014 Increased substance P expression in the trochanteric bursa of patients with greater trochanteric pain syndrome.
24486589 2014 Functional identification of cancer-specific methylation of CDO1, HOXA9, and TAC1 for the diagnosis of lung cancer.
24374326 2014 Evaluating the role of substance P in the growth of brain tumors.
24286592 2014 Substance P in heart failure: the good and the bad.
24084156 2013 Copper(II) complexes of neuropeptide gamma with point mutations (S8,16A) products of metal-catalyzed oxidation.
24010162 1983 Thyrotropin-releasing hormone, luteinizing hormone-releasing hormone and substance P immuno-reactivity in post-mortem brain from cases of Alzheimer-type dementia and Down's syndrome.
23995243 2013 Substance P and intensity of pruritus in hemodialysis and peritoneal dialysis patients.
23977290 2013 Substance P immunoreactivity exhibits frequent colocalization with kisspeptin and neurokinin B in the human infundibular region.
23873242 2013 Substance P stimulates production of inflammatory cytokines in human disc cells.
23862763 2013 Serum methylation levels of TAC1. SEPT9 and EYA4 as diagnostic markers for early colorectal cancers: a pilot study.
23827863 2013 Genetic variants of membrane metallopeptidase genes in inflammatory bowel diseases.
23737731 2013 Changes of substance P in the crevicular fluid in relation to orthodontic movement preliminary investigation.
23719583 2013 Genome-wide association study identifies a region on chromosome 11q14.3 associated with late rectal bleeding following radiation therapy for prostate cancer.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23420374 2013 Frequent promoter hypermethylation of tachykinin-1 and tachykinin receptor type 1 is a potential biomarker for head and neck cancer.
23345604 2013 Neurotransmitter substance P mediates pancreatic cancer perineural invasion via NK-1R in cancer cells.
23257919 2013 Substance P decreases fat storage and increases adipocytokine production in 3T3-L1 adipocytes.
22961239 2013 High expression of calcitonin gene-related peptide and substance P in esophageal mucosa of patients with non-erosive reflux disease.
22906243 2013 Synergism between fibronectin and transforming growth factor-?1 in the production of substance P in monocytes of patients with myelofibrosis.
22836729 2013 Substance P enhances collagen remodeling and MMP-3 expression by human tenocytes.
22733436 2012 Association of genetic variants in tachykinins pathway genes with colorectal cancer risk.
22681041 2013 Investigation of serum substance P status in patients with chronic pruritic skin lesions due to sulfur mustard: a cross-sectional study.
22572771 2012 Substance P and neprilysin in chronic pancreatitis.
22449753 2012 Cerebrospinal fluid substance P-like immunoreactivity correlates with aggression in personality disordered subjects.
22429353 2012 Serum levels of calcitonin gene-related peptide and substance P are decreased in patients with diabetes mellitus and coronary artery disease.
22392530 2012 Role for substance p-based nociceptive signaling in progenitor cell activation and angiogenesis during ischemia in mice and in human subjects.
22354721 2012 Glutamate receptors in tendinopathic patients.
22189180 2011 The possible link between the elevated serum levels of neurokinin A and anti-ribosomal P protein antibodies in children with autism.
22115773 2012 Substance P-neurokinin-1 receptor interaction upregulates monocyte tissue factor.
22057425 2012 Detection of the full-length transcript variant for neurokinin-1 receptor in human whole blood associated with enhanced reinforcement of clot by substance-P.
22020760 2012 Polymorphic markers associated with severe oxaliplatin-induced, chronic peripheral neuropathy in colon cancer patients.
21926539 2011 Validation of neurokinin a assays in the United States and Europe.
21671725 2012 Developmental regulation of TAC1 in peptidergic-induced human mesenchymal stem cells: implication for spinal cord injury in zebrafish.
21550738 2012 Profiles of blood biomarkers in alternating hemiplegia of childhood--increased MMP-9 and decreased substance P indicates its pathophysiology.
21375557 2011 Regulation of NK92-MI cell cytotoxicity by substance P.
21368235 2011 The tachykinins substance P and hemokinin-1 favor the generation of human memory Th17 cells by inducing IL-1?, IL-23, and TNF-like 1A expression by monocytes.
21314817 2011 Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-?.
21167238 2011 Distribution of substance P (SP) and vasoactive intestinal peptide (VIP) in pseudocapsules of uterine fibroids.
21160161 2010 Long-range regulatory synergy is required to allow control of the TAC1 locus by MEK/ERK signalling in sensory neurones.
21107196 2010 Changes in tissue substance P levels in patients with carpal tunnel syndrome.
21091716 2011 Neurokinin-1 receptor: functional significance in the immune system in reference to selected infections and inflammation.
21076839 2011 CD10-bearing fibroblasts may inhibit skin inflammation by down-modulating substance P.
20940324 2011 Substance P inhibits natural killer cell cytotoxicity through the neurokinin-1 receptor.
20861424 2010 Continuous subcutaneous instillation of bupivacaine compared to saline reduces interleukin 10 and increases substance P in surgical wounds after cesarean delivery.
20692311 2010 Substance P (SP) and vasoactive intestinal polypeptide (VIP) in the lower uterine segment in first and repeated cesarean sections.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20580442 2010 Common variants of the neuropeptide expressing tachykinin genes and susceptibility to asthma: a case-control study.
20529207 2010 Substance P and vasoactive intestinal peptide are reduced in right transverse colon in pediatric slow-transit constipation.
20526012 Serum concentrations of substance P in cholestasis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20497485 2010 Substance P primes lipoteichoic acid- and Pam3CysSerLys4-mediated activation of human mast cells by up-regulating Toll-like receptor 2.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20417061 2010 Low density of sympathetic nerve fibers relative to substance P-positive nerve fibers in lesional skin of chronic pruritus and prurigo nodularis.
20405330 2011 Non-synonymous polymorphism in the neuropeptide S precursor gene and sleep apnea.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20207019 2010 Midregional Proenkephalin A and N-terminal Protachykinin A are decreased in the cerebrospinal fluid of patients with dementia disorders and acute neuroinflammation.
20173430 Frequencies of polymorphisms in cytokines, neurotransmitters and adrenergic receptors in patients with complex regional pain syndrome type I after distal radial fracture.
20160043 2011 Cigarette smoke synergizes lipopolysaccharide-induced interleukin-1? and tumor necrosis factor-? secretion from macrophages via substance P-mediated nuclear factor-?B activation.
20029189 2010 Nicergoline increases serum substance P levels in patients with an ischaemic stroke.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19909213 2010 Substance P and calcitonin gene-related neuropeptides as novel growth factors for ex vivo expansion of cord blood CD34(+) hematopoietic stem cells.
19885583 2009 Substance P and NK-1R expression in oral precancerous epithelium.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19855234 2009 Biochemical testing for neuroendocrine tumors.
19812951 2010 Substance P immunoreactivity increases following human traumatic brain injury.
19695094 2009 Increased expression of matrix metalloproteinase-10, nerve growth factor and substance P in the painful degenerate intervertebral disc.
19685709 2009 [The investigation for the neuropeptides of nasal septum in perennial allergic rhinitis patient].
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19381016 2009 Substance P stimulates human airway submucosal gland secretion mainly via a CFTR-dependent process.
19279355 2009 Substance P potentiates TGFbeta-1 production in lung epithelial cell lines.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19246391 2009 RE-1-silencing transcription factor shows tumor-suppressor functions and negatively regulates the oncogenic TAC1 in breast cancer cells.
19207952 2009 Expression of substance P and neurokinin-1-receptor in laryngeal cancer: linking chronic inflammation to cancer promotion and progression.
19200949 2009 Decreased neurokinin-1 (substance P) receptor binding in patients with panic disorder: positron emission tomographic study with [18F]SPA-RQ.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19046942 2009 Aberrant silencing of the endocrine peptide gene tachykinin-1 in gastric cancer.
19036058 2009 A role for the substance P/NK-1 receptor complex in cell proliferation and apoptosis in oral lichen planus.
18990442 Mechanical stimulation induces preprotachykinin gene expression in osteoarthritic chondrocytes which is correlated with modulation of the transcription factor neuron restrictive silence factor.
18615578 2008 Pregabalin and gabapentin inhibit substance P-induced NF-kappaB activation in neuroblastoma and glioma cells.
18603306 2008 Antimicrobial activity of neuropeptides against a range of micro-organisms from skin, oral, respiratory and gastrointestinal tract sites.
18599605 2008 Substance P-mediated expression of the pro-angiogenic factor CCN1 modulates the course of colitis.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18507649 2008 Sputum neurokinin A in Egyptian asthmatic children and adolescents: relation to exacerbation severity.
18363037 2009 Prothrombotic roles of substance-P, neurokinin-1 receptors and leukocytes in the platelet-dependent clot formation in whole blood.
18316470 2008 Stromal-derived factor-1alpha induces a non-canonical pathway to activate the endocrine-linked Tac1 gene in non-tumorigenic breast cells.
18289674 2008 Observations favouring the occurrence of local production and marked effects of bombesin/gastrin-releasing peptide in the synovial tissue of the human knee joint--comparisons with substance P and the NK-1 receptor.
18211417 2008 The role of selected neuropeptides in pathogenesis of atopic dermatitis.
18197882 2008 Role of calcitonin gene-related peptide and substance P in different models of pain.
18179473 2008 Substance P regulates the expression of matrix metalloproteinases and tissue inhibitors of metalloproteinase in cultured human gingival fibroblasts.
18061399 2008 Tac1 regulation by RNA-binding protein and miRNA in bone marrow stroma: Implication for hematopoietic activity.
17975140 2007 Hypermethylation of tachykinin-1 is a potential biomarker in human esophageal cancer.
17949241 2008 Modulation of substance P signaling by dipeptidyl peptidase-IV enzymatic activity in human glioma cell lines.
17940602 2007 Severe respiratory syncytial virus bronchiolitis in infants is associated with reduced airway interferon gamma and substance P.
17855557 2007 MicroRNAs regulate synthesis of the neurotransmitter substance P in human mesenchymal stem cell-derived neuronal cells.
17709376 2007 Synergy between the RE-1 silencer of transcription and NFkappaB in the repression of the neurotransmitter gene TAC1 in human mesenchymal stem cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17667845 2007 Neurotrophins and tonsillar hypertrophy in children with obstructive sleep apnea.
17655760 2007 Do motor control genes contribute to interindividual variability in decreased movement in patients with pain?
17588657 2008 In vitro substance P-dependent induction of bone marrow cells in common (CD10) acute lymphoblastic leukaemia.
17494790 2007 Relationship between serum substance P levels and daytime sleepiness in obstructive sleep apnea syndrome.
17450584 2007 Substance P augments PGE2 and IL-6 production in titanium particles-stimulated fibroblasts from hip periprosthetic membrane.
17448763 2007 Application of HapMap data to the evaluation of 8 candidate genes for pediatric slow transit constipation.
17409218 2007 Nuclear factor-kappaB accounts for the repressor effects of high stromal cell-derived factor-1alpha levels on Tac1 expression in nontumorigenic breast cells.
17376622 2007 Tachykinin 1 (TAC1) gene SNPs and haplotypes with autism: a case-control study.
17370082 2007 Study of substance P and its receptor neurokinin-1 in psoriasis and their relation to chronic stress and pruritus.
17264209 2007 Substance P mediates antiapoptotic responses in human colonocytes by Akt activation.
17257983 2007 Do cardiac neuropeptides play a role in the occurrence of atrial fibrillation after coronary bypass surgery?
17175032 2007 The neuropeptide genes TAC1, TAC3, TAC4, VIP and PACAP(ADCYAP1), and susceptibility to multiple sclerosis.
17087112 2006 [The roles of three peptides in the pathogenesis of vasomotor rhinitis].
16952549 2006 A genome-wide search identifies epigenetic silencing of somatostatin, tachykinin-1, and 5 other genes in colon cancer.
16877367 2006 STAT-6-mediated control of P-selectin by substance P and interleukin-4 in human dermal endothelial cells.
16816831 2006 Substance P plasma concentration during the LH preovulatory surge of the menstrual cycle in the human.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16503654 2006 Three-dimensional structure of neuropeptide k bound to dodecylphosphocholine micelles.
15899028 2005 Levels of gastrin-releasing peptide and substance P in synovial fluid and serum correlate with levels of cytokines in rheumatoid arthritis.
15761654 2004 The association between calcitonin gene-related peptide (CGRP), substance P and headache in pituitary tumours.
15729363 2005 Haplotype analysis of the preprotachykinin-1 (TAC1) gene in multiple sclerosis.
15690122 2005 Autocrine proliferation of neuroblastoma cells is partly mediated through neurokinin receptors: relevance to bone marrow metastasis.
15544859 2005 Inflammatory cells as source of tachykinin-induced mucus secretion in chronic bronchitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358539 2004 Transport of somatostatin and substance P by human P-glycoprotein.
15130944 2004 Tachykinins regulate the function of platelets.
14749007 2003 [Change of neurokinin A plasma level in asthmatic children].
14703707 2003 Substance P in human tears.
14589248 Substance P-containing nerves within the human vertebral body. an immunohistochemical study of the basivertebral nerve.
14564346 2003 Elevated substance P levels in nasal lavage fluids from patients with chronic nonproductive cough and increased cough sensitivity to inhaled capsaicin.
14532289 2003 Heterodimerization of substance P and mu-opioid receptors regulates receptor trafficking and resensitization.
12871824 2003 Modulation of neuronal nicotinic receptor function by the neuropeptides CGRP and substance P on autonomic nerve cells.
12854086 2003 Substance P expression correlates with severity of diarrhea in cryptosporidiosis.
12853948 2003 The DNA sequence of human chromosome 7.
12752772 2003 Neurokinin 1 receptor and relative abundance of the short and long isoforms in the human brain.
12705477 2003 Detection of substance P and its mRNA in human blast cells in childhood lymphoblastic leukaemia using immunocytochemistry and in situ hybridisation.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12686752 2003 Roles of substance P and NK(1) receptor in the brainstem in the development of emesis.
12603817 2003 Effect of S 17092, a novel prolyl endopeptidase inhibitor, on substance P and alpha-melanocyte-stimulating hormone breakdown in the rat brain.
12578734 The role of substance P in cerebral ischemia.
12548712 2003 Human neuronal cells (NT2-N) express functional substance P and neurokinin-1 receptor coupled to MIP-1 beta expression.
12528114 2003 Tachykinin expression in cartilage and function in human articular chondrocyte mechanotransduction.
12486316 2003 Substance p-fibronectin-cytokine interactions in myeloproliferative disorders with bone marrow fibrosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12383866 2002 Substance P (NK(1)) receptor expression by human colonic epithelial cell line Caco-2.
12382579 2002 [Substance P up-regulates the TGF-beta 1 mRNA expression of human dermal fibroblasts in vitro].
12074933 2002 Direct antimicrobial properties of substance P.
11950831 2002 Involvement of the second extracellular loop (E2) of the neurokinin-1 receptor in the binding of substance P. Photoaffinity labeling and modeling studies.
11591789 2001 Induction of hypoxia-inducible factor-1alpha and activation of caspase-3 in hypoxia-reoxygenated bone marrow stroma is negatively regulated by the delayed production of substance P.
11342427 2001 Mimicry between neurokinin-1 and fibronectin may explain the transport and stability of increased substance P immunoreactivity in patients with bone marrow fibrosis.
11160316 2001 Cloning of human preprotachykinin-I promoter and the role of cyclic adenosine 5'-monophosphate response elements in its expression by IL-1 and stem cell factor.
11113362 2000 Detection of substance P and its receptor in human fetal microglia.
11104584 2000 Morphine Up-regulates expression of substance P and its receptor in human blood mononuclear phagocytes and lymphocytes.
10491292 1999 Autocrine induction of substance P mRNA and peptide in cultured normal human keratinocytes.
10189055 1998 Tachykinin receptors on human monocytes: their involvement in rheumatoid arthritis.
9847074 1998 Toward a complete human genome sequence.
9846828 1998 Identification of a delta isoform of preprotachykinin mRNA in human mononuclear phagocytes and lymphocytes.
9655475 1998 Human lymphocytes express substance P and its receptor.
9548509 1997 Human monocytes and macrophages express substance P and neurokinin-1 receptor.
9482938 1998 Hypoalgesia in mice with a targeted deletion of the tachykinin 1 gene.
9272936 1997 The role of tachykinin receptor antagonists in the prevention of bronchial hyperresponsiveness, airway inflammation and cough.
8957234 1996 Inhibitory effects of calcitonin gene-related peptide on substance-P-induced superoxide production in human neutrophils.
8702757 1996 The unpredicted high affinities of a large number of naturally occurring tachykinins for chimeric NK1/NK3 receptors suggest a role for an inhibitory domain in determining receptor specificity.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7961636 1994 The ligand binding site of the neurokinin 2 receptor. Site-directed mutagenesis and identification of neurokinin A binding residues in the human neurokinin 2 receptor.
7692486 1993 Substance P and substance P receptor histochemistry in human neurodegenerative diseases.
3770210 1986 cDNA sequence of human beta-preprotachykinin, the common precursor to substance P and neurokinin A.
3038549 1987 Isolation and characterization of neurokinin A, neurokinin A(3-10) and neurokinin A(4-10) from a neutral water extract of a metastatic ileal carcinoid tumour.
2284201 Characterization of the C-terminal flanking peptide of human beta-preprotachykinin.
1708336 1991 Tachykinin (substance-P) gene expression in Leydig cells of the human and mouse testis.
1312203 1992 Preprotachykinin gene expression in the human basal ganglia: characterization of mRNAs and pre-mRNAs produced by alternate RNA splicing.