Property Summary

NCBI Gene PubMed Count 179
PubMed Score 13651.73
PubTator Score 4666.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.20269539520574E-17
oligodendroglioma 2849 5.8556439001235E-14
pilocytic astrocytoma 3086 2.13118530582822E-9
adrenocortical carcinoma 1427 1.32163215548787E-7
facioscapulohumeral dystrophy 286 1.55996364700188E-7
glioblastoma 5572 1.64520754420538E-5
atypical teratoid / rhabdoid tumor 4369 2.53543712199075E-5
invasive ductal carcinoma 2950 4.89531433476734E-5
astrocytoma 1493 6.26749571745932E-5
pediatric high grade glioma 2712 1.77957094016147E-4
pituitary cancer 1972 5.08774045608723E-4
sonic hedgehog group medulloblastoma 1482 6.79288587020541E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00453300246955357
Down syndrome 548 0.0179704816506226
Pick disease 1893 0.0194998668733727
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0235358673500219
interstitial cystitis 2299 0.0287637431746074
Disease Target Count Z-score Confidence
Globe disease 57 0.0 1.0
colon cancer 1475 0.0 1.0

Expression

  Differential Expression (20)

Synonym

Accession P20366 O60600 O60601 Q00072 Q53GH4 Q549V0 Q549V1 Q549V2 Q6FHM1
Symbols NK2
NPK
NKNA
TAC2
Hs.2563

Gene

PDB

2KS9   2KSA   2KSB   2B19   4HOM  

  Ortholog (10)

 GO Function (1)

Gene RIF (146)

PMID Text
26852662 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/beta-arrestin 2/Rho A signaling pathway.
26349209 The spatial structures of human, mouse, and rat hemokinin-1 protein isoforms have been presented.
26038607 Circulating Neurokinin A >/= 50 ng/L is a strong indicator of poor prognosis when Neurokinin A remains above this concentration
25783846 Report absence of full-length neurokinin-1 receptor protein expression by cutaneous T cells in mycosis fungoides and discuss substance P signaling.
25750171 High TAC1 expression is associated with breast cancer.
25690155 findings suggest a proinflammatory role for SP in autoimmune inflammation
25135735 The results showed that the expression of SP and CGRP was significantly enhanced in the neurogenic SMSCs in response to IL-1beta, IL-6 and TNF-alpha, and the effect was remarkably inhibited by HA.
24969128 Decrease of mGluR5 receptor density goes parallel with changes in enkephalin and substance P immunoreactivity in Huntington's disease
24908181 Substance P was significantly increased in hypertrophic scars compared with matched unburned skin. In the reticular dermis and papillary dermis, SP represented significant correlation with pain.
24844859 Substance P is upregulated in the serum of patients with chronic spontaneous urticaria
More...

AA Sequence

MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPKPQQFFGLMGK      1 - 70
RDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNYERRR                71 - 129
//

Text Mined References (181)

PMID Year Title
26852662 2016 Substance P enhances tissue factor release from granulocyte-macrophage colony-stimulating factor-dependent macrophages via the p22phox/?-arrestin 2/Rho A signaling pathway.
26349209 [Particularities of Spatial Organization of Human Hemokinin-1 and Mouse/Rat Hemokinin-1 Molecules].
26038607 2016 Raised circulating Neurokinin A predicts prognosis in metastatic small bowel neuroendocrine tumours. Lowering Neurokinin A indicates improved prognosis.
25783846 2015 Absence of full-length neurokinin-1 receptor protein expression by cutaneous T cells: implications for substance P-mediated signaling in mycosis fungoides.
25750171 2015 APRIL promotes breast tumor growth and metastasis and is associated with aggressive basal breast cancer.
25690155 2015 Reciprocal Regulation of Substance P and IL-12/IL-23 and the Associated Cytokines, IFN?/IL-17: A Perspective on the Relevance of This Interaction to Multiple Sclerosis.
25135735 2014 Mutual effect between neuropeptides and inflammatory cytokines in neurogenic SMSCs of human temporomandibular joint.
24969128 2015 Decrease of mGluR5 receptor density goes parallel with changes in enkephalin and substance P immunoreactivity in Huntington's disease: a preliminary investigation in the postmortem human brain.
24908181 2014 Immunohistochemical analysis of neuropeptides (protein gene product 9.5, substance P and calcitonin gene-related peptide) in hypertrophic burn scar with pain and itching.
24844859 2014 Substance P is upregulated in the serum of patients with chronic spontaneous urticaria.
More...