Property Summary

NCBI Gene PubMed Count 27
PubMed Score 21.99
PubTator Score 13.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.719 7.8e-04
group 4 medulloblastoma 2.100 4.0e-04
atypical teratoid / rhabdoid tumor 1.500 1.0e-04
glioblastoma 1.500 1.2e-03
medulloblastoma, large-cell 1.900 7.9e-05
pancreatic ductal adenocarcinoma liver m... -1.183 2.9e-02
tuberculosis and treatment for 6 months 1.200 2.3e-02
spina bifida -2.510 2.8e-02
acute myeloid leukemia 1.200 2.1e-02
ovarian cancer -2.000 9.1e-07

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (19)

PMID Text
26676784 Upregulation of miR-532-5p and subsequent suppression of the SESTD1 and TAB3 genes represent an antiviral response aimed at limiting West Nile virus infection.
26555189 miR-30a in MSCs may participate in the immune dysregulation of the maternal-fetal interface during PE
24912525 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
24565101 miR-26b suppresses NF-kappaB signaling and sensitizes hepatocellular carcinoma cells to doxorubicin-induced apoptosis by inhibiting the expression of TAK1 and TAB3.
24434549 conclude that TRIM38 negatively regulates TNFalpha- and IL-1beta-induced signaling by mediating lysosome-dependent degradation of TAB2/3, two critical components in TNFalpha- and IL-1beta-induced signaling pathways
23286385 Studies show that three proteins expressed in HEK-293T cells (NAP1, TANK and TBKBP1) interact with TBK1.
22660635 MiR-23b suppresses IL-17-, tumor necrosis factor alpha (TNF-alpha)- or IL-1beta-induced NF-kappaB activation and inflammatory cytokine expression by targeting TAB2, TAB3 and IKK-alpha.
22158122 human TAB2 and TAB3, ubiquitin-chain sensory proteins involved in NF-kappaB signalling, are directly inactivated by enteropathogenic Escherichia coli NleE, a conserved bacterial type-III-secreted effector responsible for blocking host NF-kappaB signalling
22081109 These results point to the existence of an autophagy-stimulatory 'switch' whereby TAB2 and TAB3 abandon inhibitory interactions with Beclin 1 to engage in a stimulatory liaison with TAK1.
21866272 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
21575904 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
21572451 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
21512573 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
21512569 The ability of HIV-1 Vpr to activate NF-kappaB or activator protein 1-dependent luciferase expression requires TAK1, TRAF6, or TAB3 in cells
17158449 The TAB2/TAB3 interaction with TAK1 is crucial for the activation of signaling cascades mediated by interleukin-1, tumor necrosis factor, and receptor activator of nuclear factor-kappa B ligand (RANKL).
15327770 Data show that TAB2 and TAB3 are receptors that bind preferentially to polyubiquitin chains through a highly conserved zinc finger (ZnF) domain, and activate NF-kappa B and IKK.
14766965 TAB3 transforming growth factor is a constituent of the NF-kappaB pathway functioning upstream of tumor necrosis factor alpha-associated factor 6/transforming growth factor beta-activated kinase
14670075 Identification of TAB3 as a binding partner of the protein kinase TAK1.
14633987 TAB3 is involved in IL-1-induced NF-kappaB activation by physically linking TAK1 to TRAF6.

AA Sequence

MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNR      1 - 70
LLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPF     71 - 140
FMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPPPPSYMHIPRYSTNPITVTVSQNLPSGQTVP    141 - 210
RALQILPQIPSNLYGSPGSIYIRQTSQSSSGRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQY    211 - 280
SPKQQQIPQSAYHSPPPSQCPSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAY    281 - 350
LPYTASSLSKGSMKKIEITVEPSQRPGTAINRSPSPISNQPSPWNQHSLYTATTPPSSSPSRGISSQPKP    351 - 420
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIP    421 - 490
GSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEELERLKSEVNGMEHDLMQRRLR    491 - 560
RVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQSRGNFDPKAMNNFYDNIEPGPVVPPKPSKKD    561 - 630
SSDPCTIERKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPAL    631 - 700
NRCEQCEMPRYT                                                              701 - 712
//

Text Mined References (34)

PMID Year Title
26676784 2015 Human MicroRNA miR-532-5p Exhibits Antiviral Activity against West Nile Virus via Suppression of Host Genes SESTD1 and TAB3 Required for Virus Replication.
26555189 2015 MiR-30a attenuates immunosuppressive functions of IL-1?-elicited mesenchymal stem cells via targeting TAB3.
25416956 2014 A proteome-scale map of the human interactome network.
24565101 2014 MicroRNA-26b suppresses the NF-?B signaling and enhances the chemosensitivity of hepatocellular carcinoma cells by targeting TAK1 and TAB3.
24434549 2014 TRIM38 inhibits TNF?- and IL-1?-triggered NF-?B activation by mediating lysosome-dependent degradation of TAB2/3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23286385 2013 Identification of proteins that interact with TANK binding kinase 1 and testing for mutations associated with glaucoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22660635 2012 The microRNA miR-23b suppresses IL-17-associated autoimmune inflammation by targeting TAB2, TAB3 and IKK-?.
22158122 2011 Cysteine methylation disrupts ubiquitin-chain sensing in NF-?B activation.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
21976705 2012 TGF?-activated kinase 1 (TAK1)-binding proteins (TAB) 2 and 3 negatively regulate autophagy.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21512573 2011 TRIM5 is an innate immune sensor for the retrovirus capsid lattice.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19521662 2009 WDR34 is a novel TAK1-associated suppressor of the IL-1R/TLR3/TLR4-induced NF-kappaB activation pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18021073 2008 Roles for TAB1 in regulating the IL-1-dependent phosphorylation of the TAB3 regulatory subunit and activity of the TAK1 complex.
17449468 2007 RBCK1 negatively regulates tumor necrosis factor- and interleukin-1-triggered NF-kappaB activation by targeting TAB2/3 for degradation.
17158449 2007 TAK1-dependent signaling requires functional interaction with TAB2/TAB3.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15327770 2004 TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
14766965 2004 Identification of a human NF-kappaB-activating protein, TAB3.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670075 2004 TAB3, a new binding partner of the protein kinase TAK1.
14633987 2003 Role of the TAB2-related protein TAB3 in IL-1 and TNF signaling.
12609980 2003 Poly(I-C)-induced Toll-like receptor 3 (TLR3)-mediated activation of NFkappa B and MAP kinase is through an interleukin-1 receptor-associated kinase (IRAK)-independent pathway employing the signaling components TLR3-TRAF6-TAK1-TAB2-PKR .
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10882101 2000 TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.
10066798 1999 pp60(v-src) induction of cyclin D1 requires collaborative interactions between the extracellular signal-regulated kinase, p38, and Jun kinase pathways. A role for cAMP response element-binding protein and activating transcription factor-2 in pp60(v-src) signaling in breast cancer cells.