Property Summary

NCBI Gene PubMed Count 70
PubMed Score 69.05
PubTator Score 28.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.600 5.1e-03
ependymoma 1.400 1.7e-02
oligodendroglioma 1.400 1.0e-02
psoriasis -1.300 1.3e-04
osteosarcoma 2.657 7.5e-09
medulloblastoma, large-cell -1.300 7.0e-05
Pick disease 1.300 1.3e-05
ovarian cancer -1.600 2.5e-06
Gaucher disease type 3 -1.100 2.9e-03
dermatomyositis -1.200 1.6e-03

Protein-protein Interaction (8)

Gene RIF (41)

PMID Text
26432169 DK1 inhibits the formation of the TAK1-TAB2-TRAF6 complex and leads to the inhibition of TRAF6 ubiquitination.
25943894 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
24942571 Authors demonstrate that enterovirus 71 3C interacts with TAB2 and TAK1 and suppresses cytokine expression via cleavage of the TAK1 complex proteins.
24434549 conclude that TRIM38 negatively regulates TNFalpha- and IL-1beta-induced signaling by mediating lysosome-dependent degradation of TAB2/3, two critical components in TNFalpha- and IL-1beta-induced signaling pathways
24096733 SUMOylation may serve as a novel mechanism for the regulation of TAB2.
23818111 These data indicate that overexpression of TRIM22 may negatively regulate the TRAF6-stimulated NF-kappaB pathway by interacting with and degrading TAB2.
22972987 We found that endothelial TAK1 and TAB2, but not TAB1, were critically involved in vascular formation
22660635 MiR-23b suppresses IL-17-, tumor necrosis factor alpha (TNF-alpha)- or IL-1beta-induced NF-kappaB activation and inflammatory cytokine expression by targeting TAB2, TAB3 and IKK-alpha.
22249258 our data implicate Tab2 as a mediator of resistance to endocrine therapy and as a potential new target to reverse pharmacological resistance and potentiate antiestrogen action.
22190034 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
22167179 TAK1 and its adapter protein, TAB2, reciprocally regulate both TAK1- and ASK1-mediated signaling pathways to direct the activations of NF-kappaB and AP-1.
22158122 human TAB2 and TAB3, ubiquitin-chain sensory proteins involved in NF-kappaB signalling, are directly inactivated by enteropathogenic Escherichia coli NleE, a conserved bacterial type-III-secreted effector responsible for blocking host NF-kappaB signalling
22081109 These results point to the existence of an autophagy-stimulatory 'switch' whereby TAB2 and TAB3 abandon inhibitory interactions with Beclin 1 to engage in a stimulatory liaison with TAK1.
21866272 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
21700681 these studies show that the TAK1-TAB2-TAB3 signaling axis is critical for carcinoma-induced bone lesions, mediating expression of proinvasive and osteolytic factors.
21575904 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
21572451 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
21512573 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
21512569 Primary human Muller glia cells treated with both HIV-1 clade B and clade C Tat upregulate the expression of TAB-2
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21035162 The ability of human Trim5alpha to regulate TAB2 levels, to activate NF-kappaB, and to recognize retroviral capsids are genetically separable.
20948191 microRNA-155 negatively regulates the expression of TAB2 and downstream IFN-gamma-inducible protein of 10 kDa as a negative feedback system.
20875659 Co-expression of RelA and/or TAB2 markedly increased Tax-mediated NF-kappaB activation.
20493459 To confirm the role of this gene in CHDs, we performed mutation analysis of TAB2 in patients with a CHD, which revealed two d missense mutations.
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19935683 Here the authors analyze crystal structures of the TAB2 NZF domain bound to Lys63-linked di- and triubiquitin, revealing that TAB2 binds adjacent ubiquitin moieties via two distinct binding sites.
19460752 Knockdown of TGF-beta activated kinase 1/MAP3K7 binding protein 2 (TAB2; MAP3K7IP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
17986383 TAB2 may be critically involved in Tax-mediated activation of TAK1 and that NF-kappaB-activating TRAF family proteins are potential cellular E3 ubiquitin ligases toward Tax.
17626013 Tax induced persistent overexpression of TAK1-binding protein 2 (TAB2), but not TAB3, which is essential for TAK1 activation.
17586463 The current data support the notion that LMP1 modifies stress-induced apoptosis in epithelial cells through molecular interactions downstream of its C-terminal signaling domain.
17158449 The TAB2/TAB3 interaction with TAK1 is crucial for the activation of signaling cascades mediated by interleukin-1, tumor necrosis factor, and receptor activator of nuclear factor-kappa B ligand (RANKL).
16755651 Observational study of gene-disease association. (HuGE Navigator)
16755651 MAP3K7IP2 SNP did not significantly influence predisposition to and features of rheumatoid arthritis, in contrast to previous genetic and functional evidence that suggested its involvement.
16527194 A candidate gene in ectodermal dysplasia.
16384851 Observational study of gene-disease association. (HuGE Navigator)
16384851 Single nucleotide polymorphism in Graves' disease in a large UK Caucasian Graves' disease data set.
16251197 Involvement of the TAB2/TRAF6/TAK1 signalling complex in the Edar signal transduction pathway has important implications for understanding of NF-kappaB activation and anhidrotic ectodermal dysplasia in human.
15590691 characterized the molecular mechanisms of cellular stress-induced TAK1 activation, focusing mainly on the phosphorylation of TAK1 at Thr-187 and Ser-192 in the activation loop; TAB1 and TAB2 were differentially involved in the phosphorylation of TAK1
15327770 Data show that TAB2 and TAB3 are receptors that bind preferentially to polyubiquitin chains through a highly conserved zinc finger (ZnF) domain, and activate NF-kappa B and IKK.
15220215 Both TAB2 and SUMO are involved in NF-kappaB activation and may thus be involved in type 1 diabetes through apoptosis in pancreatic beta-cells.
12242293 Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.

AA Sequence

MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISG      1 - 70
LRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVF     71 - 140
GMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGVPPPVLNSPQG    141 - 210
NSIYIRPYITTPGGTTRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQT    211 - 280
SHVYMPISSPTTSQPPTIHSSGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSS    281 - 350
TSSSVNSQTLNRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR    351 - 420
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNL    421 - 490
LNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDK    491 - 560
LKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQARGPHFNPSAIHN    561 - 630
FYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF           631 - 693
//

Text Mined References (80)

PMID Year Title
26432169 2015 Phosphoinositide-dependent kinase-1 inhibits TRAF6 ubiquitination by interrupting the formation of TAK1-TAB2 complex in TLR4 signaling.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
24942571 2014 Enterovirus 71 3C inhibits cytokine expression through cleavage of the TAK1/TAB1/TAB2/TAB3 complex.
24498425 2014 TAK1 binding protein 2 is essential for liver protection from stressors.
24434549 2014 TRIM38 inhibits TNF?- and IL-1?-triggered NF-?B activation by mediating lysosome-dependent degradation of TAB2/3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24096733 2014 TAB2, an important upstream adaptor of interleukin-1 signaling pathway, is subject to SUMOylation.
23818111 2013 TRIM22 inhibits the TRAF6-stimulated NF-?B pathway by targeting TAB2 for degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22972987 2012 TAK1 kinase signaling regulates embryonic angiogenesis by modulating endothelial cell survival and migration.
22660635 2012 The microRNA miR-23b suppresses IL-17-associated autoimmune inflammation by targeting TAB2, TAB3 and IKK-?.
22383897 2012 Genome-wide association study in east Asians identifies novel susceptibility loci for breast cancer.
22249258 2012 Targeting of the adaptor protein Tab2 as a novel approach to revert tamoxifen resistance in breast cancer cells.
22167179 2012 Reciprocal inhibition between the transforming growth factor-?-activated kinase 1 (TAK1) and apoptosis signal-regulating kinase 1 (ASK1) mitogen-activated protein kinase kinase kinases and its suppression by TAK1-binding protein 2 (TAB2), an adapter protein for TAK1.
22158122 2011 Cysteine methylation disrupts ubiquitin-chain sensing in NF-?B activation.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21976705 2012 TGF?-activated kinase 1 (TAK1)-binding proteins (TAB) 2 and 3 negatively regulate autophagy.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21732829 2011 Wnt signaling and Dupuytren's disease.
21700681 2011 TAK1-TAB2 signaling contributes to bone destruction by breast carcinoma cells.
21512573 2011 TRIM5 is an innate immune sensor for the retrovirus capsid lattice.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21035162 2011 Human Trim5? has additional activities that are uncoupled from retroviral capsid recognition.
20948191 2010 IFN-? and TNF-? synergistically induce microRNA-155 which regulates TAB2/IP-10 expression in human mesangial cells.
20875659 2010 Association of HTLV Tax proteins with TAK1-binding protein 2 and RelA in calreticulin-containing cytoplasmic structures participates in Tax-mediated NF-?B activation.
20493459 2010 Haploinsufficiency of TAB2 causes congenital heart defects in humans.
20448286 2010 Association between anti-tumour necrosis factor treatment response and genetic variants within the TLR and NF{kappa}B signalling pathways.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19935683 2009 Two-sided ubiquitin binding explains specificity of the TAB2 NZF domain.
19875381 2010 A proteomic investigation of ligand-dependent HSP90 complexes reveals CHORDC1 as a novel ADP-dependent HSP90-interacting protein.
19675569 2009 Direct activation of protein kinases by unanchored polyubiquitin chains.
19521662 2009 WDR34 is a novel TAK1-associated suppressor of the IL-1R/TLR3/TLR4-induced NF-kappaB activation pathway.
19026643 2008 HSP90 is required for TAK1 stability but not for its activation in the pro-inflammatory signaling pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18299187 2008 NUMBL interacts with TAB2 and inhibits TNFalpha and IL-1beta-induced NF-kappaB activation.
17986383 2008 HTLV-1 Tax-mediated TAK1 activation involves TAB2 adapter protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
17626013 2007 Constitutive activation of TAK1 by HTLV-1 tax-dependent overexpression of TAB2 induces activation of JNK-ATF2 but not IKK-NF-kappaB.
17586463 2007 Epstein-Barr virus-encoded LMP1 promotes cisplatin-induced caspase activation through JNK and NF-kappaB signaling pathways.
17449468 2007 RBCK1 negatively regulates tumor necrosis factor- and interleukin-1-triggered NF-kappaB activation by targeting TAB2/3 for degradation.
17158449 2007 TAK1-dependent signaling requires functional interaction with TAB2/TAB3.
17047224 2006 Regulation and function of IKK and IKK-related kinases.
16845370 2006 The Yersinia enterocolitica effector YopP inhibits host cell signalling by inactivating the protein kinase TAK1 in the IL-1 signalling pathway.
16755651 2006 SUMO4 and MAP3K7IP2 single nucleotide polymorphisms and susceptibility to rheumatoid arthritis.
16527194 2006 [New genes candidates for ectodermal dysplasia: TAB2, TRAF6 and TAK1].
16384851 2006 Contribution of single nucleotide polymorphisms within FCRL3 and MAP3K7IP2 to the pathogenesis of Graves' disease.
16251197 2005 TAB2, TRAF6 and TAK1 are involved in NF-kappaB activation induced by the TNF-receptor, Edar and its adaptator Edaradd.
15590691 2005 Critical roles of threonine 187 phosphorylation in cellular stress-induced rapid and transient activation of transforming growth factor-beta-activated kinase 1 (TAK1) in a signaling complex containing TAK1-binding protein TAB1 and TAB2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15327770 2004 TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15220215 2004 A 212-kb region on chromosome 6q25 containing the TAB2 gene is associated with susceptibility to type 1 diabetes.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670075 2004 TAB3, a new binding partner of the protein kinase TAK1.
14633987 2003 Role of the TAB2-related protein TAB3 in IL-1 and TNF signaling.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12609980 2003 Poly(I-C)-induced Toll-like receptor 3 (TLR3)-mediated activation of NFkappa B and MAP kinase is through an interleukin-1 receptor-associated kinase (IRAK)-independent pathway employing the signaling components TLR3-TRAF6-TAK1-TAB2-PKR .
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242293 2002 Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12150997 2002 Exchange of N-CoR corepressor and Tip60 coactivator complexes links gene expression by NF-kappaB and beta-amyloid precursor protein.
12048196 2002 ILPIP, a novel anti-apoptotic protein that enhances XIAP-mediated activation of JNK1 and protection against apoptosis.
11809792 2002 Receptor activator of NF-kappaB ligand (RANKL) activates TAK1 mitogen-activated protein kinase kinase kinase through a signaling complex containing RANK, TAB2, and TRAF6.
11518704 2001 IRAK-mediated translocation of TRAF6 and TAB2 in the interleukin-1-induced activation of NFkappa B.
11460167 2001 TAK1 is a ubiquitin-dependent kinase of MKK and IKK.
11259596 2001 Interleukin-1 (IL-1) receptor-associated kinase leads to activation of TAK1 by inducing TAB2 translocation in the IL-1 signaling pathway.
10882101 2000 TAB2, a novel adaptor protein, mediates activation of TAK1 MAPKKK by linking TAK1 to TRAF6 in the IL-1 signal transduction pathway.
10066798 1999 pp60(v-src) induction of cyclin D1 requires collaborative interactions between the extracellular signal-regulated kinase, p38, and Jun kinase pathways. A role for cAMP response element-binding protein and activating transcription factor-2 in pp60(v-src) signaling in breast cancer cells.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9744859 1998 Tumor necrosis factor receptor-associated factors (TRAFs)--a family of adapter proteins that regulates life and death.
9162092 1997 Characterization of the mitogen-activated protein kinase kinase 4 (MKK4)/c-Jun NH2-terminal kinase 1 and MKK3/p38 pathways regulated by MEK kinases 2 and 3. MEK kinase 3 activates MKK3 but does not cause activation of p38 kinase in vivo.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8638164 1996 TAB1: an activator of the TAK1 MAPKKK in TGF-beta signal transduction.