Property Summary

NCBI Gene PubMed Count 63
PubMed Score 84.86
PubTator Score 19.19

Knowledge Summary

Patent (9,251)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 7.9e-04
atypical teratoid / rhabdoid tumor -1.300 3.7e-05
glioblastoma -1.500 5.5e-06
juvenile dermatomyositis -1.073 2.8e-11
medulloblastoma, large-cell -1.300 1.5e-04
non primary Sjogren syndrome sicca 1.200 1.4e-02
osteosarcoma -1.180 1.8e-06

Protein-protein Interaction (9)

PDB (28)

Gene RIF (24)

AA Sequence

MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNG      1 - 70
YDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVP     71 - 140
QHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTE    141 - 210
NEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDG    211 - 280
VTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAR    281 - 350
FCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG    351 - 420
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRL    421 - 490
WSVDHGEQSVVTAP                                                            491 - 504
//

Text Mined References (72)

PMID Year Title