Property Summary

NCBI Gene PubMed Count 63
PubMed Score 84.86
PubTator Score 19.19

Knowledge Summary

Patent (9,251)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 7.9e-04
atypical teratoid / rhabdoid tumor -1.300 3.7e-05
glioblastoma -1.500 5.5e-06
juvenile dermatomyositis -1.073 2.8e-11
medulloblastoma, large-cell -1.300 1.5e-04
non primary Sjogren syndrome sicca 1.200 1.4e-02
osteosarcoma -1.180 1.8e-06

Synonym

Accession Q15750 Q2PP09 Q8IZW2
Symbols 3'-Tab1
MAP3K7IP1

Gene

PDB

2YIY   4GS6   4L3P   4L52   4L53   4O91   5E7R   5GJD   5GJF   5GJG   5J7S   5J8I   5J9L   5JGA   5JGB   5JGD   5JH6   5JK3   5V5N   2POP   4AY5   4AY6   5VVU   2J4O   2POM   2YDS   4KA3   5DIY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

Gene RIF (24)

AA Sequence

MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNG      1 - 70
YDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVP     71 - 140
QHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTE    141 - 210
NEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDG    211 - 280
VTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERAR    281 - 350
FCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG    351 - 420
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRL    421 - 490
WSVDHGEQSVVTAP                                                            491 - 504
//

Text Mined References (72)

PMID Year Title