Property Summary

Ligand Count 2
NCBI Gene PubMed Count 10
PubMed Score 143.64
PubTator Score 41.42

Knowledge Summary

Patent (10,169)

TINX Plot

  Disease (2)

Gene RIF (3)

AA Sequence

MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTN      1 - 70
FLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPL     71 - 140
LYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFV    141 - 210
PCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHF    211 - 280
ITPPLVFDIFIWFAYFNSACNPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE                 281 - 337
//

Text Mined References (10)

PMID Year Title