Property Summary

NCBI Gene PubMed Count 23
PubMed Score 290.30
PubTator Score 124.37

Knowledge Summary

Patent (42,640)

MLP Assay (16)

AID Type Active / Inconclusive / Inactive Description
624466 screening 5386 / 0 / 357491 Fluorescence-based cell-based primary high throughput screening assay to identify antagonists of the human trace amine associated receptor 1 (TAAR1)
624467 screening 3577 / 0 / 359300 Fluorescence-based cell-based primary high throughput screening assay to identify agonists of the human trace amine associated receptor 1 (TAAR1)
624475 summary 0 / 0 / 0 Summary of the probe development effort to identify antagonists of the human trace amine associated receptor 1 (TAAR1)
624477 summary 0 / 0 / 0 Summary of the probe development effort to identify agonists of the human trace amine associated receptor 1 (TAAR1)
651783 screening 1973 / 0 / 428 Fluorescence-based cell-based primary high throughput confirmation assay to identify agonists of the human trace amine associated receptor 1 (TAAR1)
651785 screening 947 / 0 / 1433 Fluorescence-based cell-based primary high throughput confirmation assay to identify antagonists of the human trace amine associated receptor 1 (TAAR1)
651951 screening 1099 / 0 / 1302 Counterscreen for agonists of the human trace amine associated receptor 1 (hTAAR1): Fluorescence-based cell-based high throughput screening assay to identify hTAAR1 agonists that also desensitize TAAR1 receptor response.
651955 screening 41 / 0 / 2339 Counterscreen for antagonists of the human trace amine associated receptor 1 (hTAAR1): Fluorescence-based cell-based high throughput screening assay to identify TAAR1 Agonists
686984 confirmatory 272 / 0 / 143 Counterscreen for agonists of the human trace amine associated receptor 1 (hTAAR1): Fluorescence-based cell-based high throughput dose response assay to identify hTAAR1 agonist that also desensitize TAAR1 receptor response.
686985 confirmatory 376 / 0 / 39 Fluorescence-based cell-based high throughput dose response assay to identify agonists of the human trace amine associated receptor 1 (TAAR1)
More...

Gene RIF (11)

PMID Text
27031617 SNPs in human TAAR1 alter its function, resulting in expressed, but functional, sub-functional and non-functional receptors
23315425 biogenic amines potently regulate blood cell functions via TAAR1 and TAAR2 and open the perspective of their specific pharmacological modulation.
22114263 Trace amine 1 receptors (TA1R) exert an inhibitory influence on both dopaminergic and serotonergic transmission, and MDMA (ecstasy) auto-inhibits its neurochemical and functional actions by recruitment of TA1R.
22079347 Methamphetamine-but not morphine-induced conditioned place preference was augmented in TAAR1 transgenic mice.
22038157 an increase in TAAR1 receptor expression is concomitant with lymphocyte immune activation, suggesting a possible role for TAAR1 in the generation or regulation of an immune response
21670104 data suggest that TAAR1 and D2R have functional and physical interactions that could be critical for the modulation of the dopaminergic system by TAAR1 in vivo
21073468 Overview focuses on recent studies which reveal a role for TAAR1 in the functional regulation of monoamine transporters and the neuronal regulatory mechanisms that modulate dopaminergic activity. [review]
19892733 Data support that TAAR1 tonically activates inwardly rectifying K(+) channels, which reduces the basal firing frequency of dopamine neurons in the ventral tegmental area.
18602830 A systematic evaluation of a series of beta-phenethylamines as ligands to TAAR1 is reported.
17900709 Expression of neuronal trace amine-associated receptor (Taar) mRNAs in leukocytes.
16878137 Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.

AA Sequence

MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDF      1 - 70
LLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVI     71 - 140
CVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVY    141 - 210
YRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYI    211 - 280
IPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS               281 - 339
//

Text Mined References (23)

PMID Year Title
27031617 2016 Genetic Polymorphisms Affect Mouse and Human Trace Amine-Associated Receptor 1 Function.
24950453 2014 Methamphetamine and HIV-1-induced neurotoxicity: role of trace amine associated receptor 1 cAMP signaling in astrocytes.
24894156 2014 Further insights into the pharmacology of the human trace amine-associated receptors: discovery of novel ligands for TAAR1 by a virtual screening approach.
23315425 2013 Biogenic amines activate blood leukocytes via trace amine-associated receptors TAAR1 and TAAR2.
22883051 2013 Insights into the structure and pharmacology of the human trace amine-associated receptor 1 (hTAAR1): homology modelling and docking studies.
22114263 2011 Genetic deletion of trace amine 1 receptors reveals their role in auto-inhibiting the actions of ecstasy (MDMA).
22079347 2012 Augmentation of methamphetamine-induced behaviors in transgenic mice lacking the trace amine-associated receptor 1.
22038157 2012 Trace amine associated receptor 1 signaling in activated lymphocytes.
21670104 2011 Functional interaction between trace amine-associated receptor 1 and dopamine D2 receptor.
21073468 2011 The emerging role of trace amine-associated receptor 1 in the functional regulation of monoamine transporters and dopaminergic activity.
19892733 2009 The selective antagonist EPPTB reveals TAAR1-mediated regulatory mechanisms in dopaminergic neurons of the mesolimbic system.
18602830 2008 Structure-activity correlations for beta-phenethylamines at human trace amine receptor 1.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17900709 2007 Expression of neuronal trace amine-associated receptor (Taar) mRNAs in leukocytes.
16878137 2006 A second class of chemosensory receptors in the olfactory epithelium.
15718104 2005 Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11723224 2001 Amphetamine, 3,4-methylenedioxymethamphetamine, lysergic acid diethylamide, and metabolites of the catecholamine neurotransmitters are agonists of a rat trace amine receptor.
11459929 2001 Trace amines: identification of a family of mammalian G protein-coupled receptors.