Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.73
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.400 3.7e-03
ependymoma -2.400 8.0e-03
oligodendroglioma -2.200 5.1e-03
glioblastoma multiforme -1.400 8.7e-17
osteosarcoma 1.553 1.0e-02
medulloblastoma -2.800 3.0e-07
atypical teratoid / rhabdoid tumor -2.100 3.1e-05
medulloblastoma, large-cell -2.700 6.5e-04
adrenocortical carcinoma -2.841 7.6e-05
interstitial cystitis -1.800 6.4e-04
adult high grade glioma -1.400 2.5e-02
Breast cancer 1.800 1.0e-02
nasopharyngeal carcinoma -1.200 2.4e-03
spina bifida -1.969 4.6e-02

Gene RIF (3)

PMID Text
16630545 These observations decisively prove that Rab27a inhibits ENaC function through a complex mechanism that involves GTP/GDP status, and protein-protein interactions involving Munc13-4 and SLP-5 effector proteins.
12051743 molecular cloning of slp5:a novel Rab27A effector with C-terminal tandem C2 domains
12051743 Synaptotagmin-like protein 5 (Slp5) contains an N-terminal Slp homology domain (SHD) (PMID: 11327731). The SHD of Slp5 specifically and directly binds the GTP-bound form of Rab27A.

AA Sequence

MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTQQEASRVCVHCHRN      1 - 70
LGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVR     71 - 140
QSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSY    141 - 210
SLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYG    211 - 280
FENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSIRSKSVPG    281 - 350
ALDKDSLEETEESIDALVSSQLSTNTHRLASGLSTTSLNSMMSVYSETGDYGNVKVSGEILLHISYCYKT    351 - 420
GGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTGTNPEFNETLKYTISHTQLETRT    421 - 490
LQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIGLQYKGELTVVLRYIPPEENL    491 - 560
MLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLV    561 - 630
IKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEE    631 - 700
QRLWQKMANNPGTPFEGVLMLRSSMGKCRL                                            701 - 730
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23568457 2013 Genetic variants associated with disordered eating.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
16630545 2006 Rab27a regulates epithelial sodium channel (ENaC) activity through synaptotagmin-like protein (SLP-5) and Munc13-4 effector mechanism.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051743 2002 Synaptotagmin-like protein 5: a novel Rab27A effector with C-terminal tandem C2 domains.