Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.36
PubTator Score 2.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 2.9e-13
ependymoma 4679 3.0e-10
tuberculosis 2010 8.5e-07
glioblastoma 5792 1.1e-05
osteosarcoma 7950 1.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Chediak-Higashi syndrome 26 3.046 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.300 3.0e-10
glioblastoma 1.100 1.1e-05
lung carcinoma -1.600 2.9e-13
osteosarcoma -1.588 1.2e-05
tuberculosis -1.600 8.5e-07

Gene RIF (5)

AA Sequence

MAQEIDLSALKELEREAILQVLYRDQAVQNTEEERTRKLKTHLQHLRWKGAKNTDWEHKEKCCARCQQVL      1 - 70
GFLLHRGAVCRGCSHRVCAQCRVFLRGTHAWKCTVCFEDRNVKIKTGEWFYEERAKKFPTGGKHETVGGQ     71 - 140
LLQSYQKLSKISVVPPTPPPVSESQCSRSPGRLQEFGQFRGFNKSVENLFLSLATHVKKLSKSQNDMTSE    141 - 210
KHLLATGPRQCVGQTERRSQSDTAVNVTTRKVSAPDILKPLNQEDPKCSTNPILKQQNLPSSPAPSTIFS    211 - 280
GGFRHGSLISIDSTCTEMGNFDNANVTGEIEFAIHYCFKTHSLEICIKACKNLAYGEEKKKKCNPYVKTY    281 - 350
LLPDRSSQGKRKTGVQRNTVDPTFQETLKYQVAPAQLVTRQLQVSVWHLGTLARRVFLGEVIIPLATWDF    351 - 420
EDSTTQSFRWHPLRAKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQEAQEGTDQPSLHGQLCLVVLGAK    421 - 490
NLPVRPDGTLNSFVKGCLTLPDQQKLRLKSPVLRKQACPQWKHSFVFSGVTPAQLRQSSLELTVWDQALF    491 - 560
GMNDRLLGGTRLGSKGDTAVGGDACSLSKLQWQKVLSSPNLWTDMTLVLH                        561 - 610
//

Text Mined References (13)

PMID Year Title