Property Summary

NCBI Gene PubMed Count 31
PubMed Score 19.29
PubTator Score 22.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
urothelial carcinoma -1.700 4.4e-02
malignant mesothelioma -2.500 5.4e-07
astrocytic glioma -1.500 4.4e-02
ependymoma -2.300 1.8e-03
oligodendroglioma -2.100 1.8e-02
osteosarcoma 4.525 4.7e-06
group 3 medulloblastoma -2.900 1.3e-03
atypical teratoid / rhabdoid tumor -2.700 5.7e-05
medulloblastoma, large-cell -3.600 3.4e-04
primitive neuroectodermal tumor -2.000 2.7e-03
Duchenne muscular dystrophy 1.600 6.4e-07
juvenile dermatomyositis 1.546 6.9e-10
adrenocortical adenoma 1.299 3.3e-02
primary pancreatic ductal adenocarcinoma 2.689 3.8e-03
tuberculosis -1.800 4.6e-07
intraductal papillary-mucinous adenoma (... 3.000 5.9e-05
intraductal papillary-mucinous carcinoma... 2.500 1.6e-03
intraductal papillary-mucinous neoplasm ... 2.500 8.1e-03
colon cancer -1.900 2.8e-02
lung cancer 2.900 2.4e-03
pancreatic cancer 2.300 1.7e-02
fibroadenoma 1.300 4.5e-03
interstitial cystitis -1.100 8.7e-04
nasopharyngeal carcinoma -1.600 6.8e-04
lung carcinoma -1.400 5.4e-14
ductal carcinoma in situ 1.200 8.6e-03
invasive ductal carcinoma 1.300 2.6e-02
ulcerative colitis -1.600 3.5e-06
ovarian cancer 2.900 2.1e-04
pituitary cancer 1.100 4.9e-02
head and neck cancer -1.100 2.0e-02

Gene RIF (11)

PMID Text
25940347 SLP2 is a Rab27a effector required for HIV-1 Gag assembly at the plasma membrane in Jurkat cells
25940347 Silencing of SLP2 by shRNA inhibits HIV-1 replication in Jurkat cells
21223688 SLP2 may play an important role in tumorigenesis of esophageal squamous cell carcinoma.
20729199 Calmodulin suppresses synaptotagmin-2 transcription in cortical neurons
20654157 A high expression level of SLP-2 may be associating with the development of invasion and metastasis in laryngeal squamous cell carcinoma and breast cancer.
18832576 Rab27A/Slp2a expression in limb girdle muscular dystrophy 2B muscle provides a compensatory vesicular trafficking pathway that is able to repair membrane damage in the absence of dysferlin.
18812475 Rab27a recruits Slp2a-hem on vesicular structures in peripheral CTLs and following CTL-target cell conjugate formation, the Slp2a-hem/Rab27a complex colocalizes with perforin-containing granules at the immunologic synapse
18266782 These results suggest that both Slp1 and Slp2-a may form part of a docking complex, capturing secretory lysosomes at the immunological synapse.
17672918 occurrence of an unusual TG 3' splice site in intron 9
17182843 Exophilin4/Slp2-a is specifically expressed in pancreatic alpha cells.
11773082 Synaptotagmin-like protein 2-a (Slp2-a) contains an N-terminal Slp homology domain (SHD) (PMID: 11327731). The SHD of Slp2-a specifically and directly binds the GTP-bound form of Rab27A.

AA Sequence

MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGAD      1 - 70
IIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSV     71 - 140
IDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTS    141 - 210
IQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSS    211 - 280
STDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHG    281 - 350
REVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGL    351 - 420
HSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEE    421 - 490
EPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMS    491 - 560
KSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKG    561 - 630
NIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEIL    631 - 700
RYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRG    701 - 770
EMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTN    771 - 840
PIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKM    841 - 910
VNSPNTWIEATLPLRMLLIAKISK                                                  911 - 934
//

Text Mined References (33)

PMID Year Title
24284068 2014 Slp2-a controls renal epithelial cell size through regulation of Rap-ezrin signaling independently of Rab27.
22820376 2012 Synaptotagmin-like proteins control the formation of a single apical membrane domain in epithelial cells.
22724020 2012 Deregulation of Rab and Rab effector genes in bladder cancer.
21223688 2010 [Expression of SLP-2 protein in esophageal squamous cell carcinoma is associated with cancer invasion].
20729199 2010 Calmodulin suppresses synaptotagmin-2 transcription in cortical neurons.
20654157 2010 [Relationship between SLP-2 expression and prognosis in laryngeal squamous cell carcinoma and mammary invasive carcinoma].
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18940603 2008 Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a.
18832576 2008 Dysferlin deficiency shows compensatory induction of Rab27A/Slp2a that may contribute to inflammatory onset.
18812475 2008 A newly identified isoform of Slp2a associates with Rab27a in cytotoxic T cells and participates to cytotoxic granule secretion.
18266782 2008 Slp1 and Slp2-a localize to the plasma membrane of CTL and contribute to secretion from the immunological synapse.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17182843 2007 Exophilin4/Slp2-a targets glucagon granules to the plasma membrane through unique Ca2+-inhibitory phospholipid-binding activity of the C2A domain.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12590134 2003 Slp4-a/granuphilin-a inhibits dense-core vesicle exocytosis through interaction with the GDP-bound form of Rab27A in PC12 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11773082 2002 The Slp homology domain of synaptotagmin-like proteins 1-4 and Slac2 functions as a novel Rab27A binding domain.
11543631 2001 Genomic analysis of synaptotagmin genes.
11327731 2001 Novel splicing isoforms of synaptotagmin-like proteins 2 and 3: identification of the Slp homology domain.
11243866 2001 Synaptotagmin-like protein 1-3: a novel family of C-terminal-type tandem C2 proteins.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10865129 2000 Double C2 protein. A review.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8976547 1996 The C2 domain calcium-binding motif: structural and functional diversity.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.