Property Summary

NCBI Gene PubMed Count 32
PubMed Score 19.51
PubTator Score 22.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (31)

Disease log2 FC p
adrenocortical adenoma 1.299 3.3e-02
astrocytic glioma -1.500 4.4e-02
atypical teratoid / rhabdoid tumor -1.900 2.1e-03
colon cancer -1.900 2.8e-02
Duchenne muscular dystrophy 1.255 4.8e-07
ductal carcinoma in situ 1.200 8.6e-03
ependymoma -2.300 1.8e-03
fibroadenoma 1.300 4.5e-03
group 3 medulloblastoma -2.900 1.3e-03
head and neck cancer -1.100 2.0e-02
interstitial cystitis -1.100 8.7e-04
intraductal papillary-mucinous adenoma (... 3.000 5.9e-05
intraductal papillary-mucinous carcinoma... 2.500 1.6e-03
intraductal papillary-mucinous neoplasm ... 2.200 6.8e-03
invasive ductal carcinoma 1.300 2.6e-02
juvenile dermatomyositis 1.274 2.3e-09
lung cancer 2.900 2.4e-03
lung carcinoma -1.400 5.4e-14
malignant mesothelioma -2.500 5.4e-07
medulloblastoma, large-cell -2.700 3.6e-03
nasopharyngeal carcinoma -1.500 6.4e-04
oligodendroglioma -1.900 1.3e-02
osteosarcoma 3.000 2.3e-03
ovarian cancer 1.100 7.4e-03
pancreatic cancer 1.400 5.6e-04
pancreatic ductal adenocarcinoma liver m... 1.633 3.4e-02
pituitary cancer 1.100 4.9e-02
primitive neuroectodermal tumor -1.800 2.3e-02
tuberculosis -1.800 4.6e-07
ulcerative colitis -1.300 3.4e-07
urothelial carcinoma -1.600 2.8e-03

Gene RIF (12)

AA Sequence

MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGAD      1 - 70
IIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSV     71 - 140
IDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTS    141 - 210
IQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSS    211 - 280
STDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHG    281 - 350
REVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGL    351 - 420
HSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEE    421 - 490
EPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMS    491 - 560
KSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKG    561 - 630
NIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEIL    631 - 700
RYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRG    701 - 770
EMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTN    771 - 840
PIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKM    841 - 910
VNSPNTWIEATLPLRMLLIAKISK                                                  911 - 934
//

Text Mined References (34)

PMID Year Title