Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.64
PubTator Score 7.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma -1.500 8.9e-06
group 3 medulloblastoma -2.000 7.6e-04
primitive neuroectodermal tumor -1.100 3.4e-02
adult high grade glioma -1.700 5.2e-04
atypical teratoid/rhabdoid tumor -1.100 9.0e-04
pilocytic astrocytoma -1.400 1.5e-04
subependymal giant cell astrocytoma -2.412 5.7e-03
ovarian cancer -1.600 1.2e-07
pituitary cancer 1.700 6.3e-06
psoriasis -3.900 2.3e-107

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVS      1 - 70
LFVSWKLCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLST     71 - 140
QTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDN    141 - 210
DDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKT    211 - 280
LNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDN    281 - 350
VDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN    351 - 420
EAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLVEK    421 - 490
R//

Text Mined References (17)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15066994 2004 Regulated exocytosis contributes to protein kinase C potentiation of vanilloid receptor activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12966166 2003 Synaptotagmin IX, a possible linker between the perinuclear endocytic recycling compartment and the microtubules.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12062430 2002 Identification of casein kinase Ialpha interacting protein partners.
12062043 2002 Ca2+-dependent synaptotagmin binding to SNAP-25 is essential for Ca2+-triggered exocytosis.
11751925 2002 Synaptotagmin IX regulates Ca2+-dependent secretion in PC12 cells.
11543631 2001 Genomic analysis of synaptotagmin genes.
10734137 2000 SYNCRIP, a cytoplasmic counterpart of heterogeneous nuclear ribonucleoprotein R, interacts with ubiquitous synaptotagmin isoforms.
8901523 1996 Mirror image motifs mediate the interaction of the COOH terminus of multiple synaptotagmins with the neurexins and calmodulin.