Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.64
PubTator Score 3.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
inflammatory breast cancer -1.700 9.4e-04
interstitial cystitis -1.700 5.0e-03
pancreatic cancer 1.100 1.3e-03
pancreatic ductal adenocarcinoma liver m... 2.106 3.0e-02
psoriasis -1.200 2.2e-30

Gene RIF (4)

AA Sequence

MLHLHGWQTMQGRKMGHPPVSPSAPAPAGTTAIPGLIPDLVAGTPWPRWALIAGALAAGVLLVSCLLCAA      1 - 70
CCCCRRHRKKPRDKESVGLGSARGTTTTHLVQPDVDGLESSPGDAQQWGCLQLSLEFDFGSQEIRVGLRQ     71 - 140
AADLRPGGTVDPYARVSVSTQAGHRHETKVHRGTLCPVFDETCCFHIPQAELPGATLQVQLFNFKRFSGH    141 - 210
EPLGELRLPLGTVDLQHVLEHWYLLGPPAATQPEQVGELCFSLRYVPSSGRLTVVVLEARGLRPGLAEPY    211 - 280
VKVQLMLNQRKWKKRKTATKKGTAAPYFNEAFTFLVPFSQVQNVDLVLAVWDRSLPLRTEPVGKVHLGAR    281 - 350
ASGQPLQHWADMLAHARRPIAQRHPLRPAREVDRMLALQPRLRLRLPLPHS                       351 - 401
//

Text Mined References (12)

PMID Year Title