Property Summary

NCBI Gene PubMed Count 16
PubMed Score 48.40
PubTator Score 24.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma -1.900 1.9e-10
astrocytoma -1.600 1.3e-24
glioblastoma -2.100 6.2e-11
oligodendroglioma -1.600 4.2e-20
osteosarcoma 1.152 2.5e-06
group 4 medulloblastoma -2.300 5.9e-06
atypical teratoid/rhabdoid tumor -2.400 1.1e-10
medulloblastoma, large-cell -1.300 2.2e-04
primitive neuroectodermal tumor -1.400 5.7e-04
pediatric high grade glioma -2.200 3.6e-07
pilocytic astrocytoma -2.500 2.5e-10
lung carcinoma 3.400 1.4e-50
ovarian cancer -1.100 9.8e-05
pituitary cancer -1.900 7.8e-06

Gene RIF (5)

PMID Text
25437758 the results suggest that the two C2 domains of Syt7 bind independently to planar membranes, in contrast to reported interdomain cooperativity in Syt1
22966849 The membrane dissociation of SYT7 C2A domain but not SYT1 C2A domain is slowed by Na(2)SO(4) and trehalose, solutes that enhance the hydrophobic effect.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12071850 identified the conserved alternative splicing events in the spacer domain of Syt VII; also shown that Syt VIIa-GFP is mainly localized in the perinuclear region and tips of neurites (dense-core vesicles), and not in the plasma membrane

AA Sequence

MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPDSGRGRSEKKA      1 - 70
IKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQ     71 - 140
FSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFP    141 - 210
YEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSA    211 - 280
NSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETT    281 - 350
IIITVMDKDKLSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA                     351 - 403
//

Text Mined References (21)

PMID Year Title
26333120 2015 Membrane Docking of the Synaptotagmin 7 C2A Domain: Computation Reveals Interplay between Electrostatic and Hydrophobic Contributions.
26322740 2015 Membrane Docking of the Synaptotagmin 7 C2A Domain: Electron Paramagnetic Resonance Measurements Show Contributions from Two Membrane Binding Loops.
25437758 2014 Lateral diffusion of proteins on supported lipid bilayers: additive friction of synaptotagmin 7 C2A-C2B tandem domains.
25416956 2014 A proteome-scale map of the human interactome network.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22966849 2012 Hydrophobic contributions to the membrane docking of synaptotagmin 7 C2A domain: mechanistic contrast between isoforms 1 and 7.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15811535 2005 Trypanosoma cruzi invades synaptotagmin VII-deficient cells by a PI-3 kinase independent pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12526776 2003 Sr2+ binding to the Ca2+ binding site of the synaptotagmin 1 C2B domain triggers fast exocytosis without stimulating SNARE interactions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12071850 2002 Alternative splicing isoforms of synaptotagmin VII in the mouse, rat and human.
11342594 2001 The Exocytosis-regulatory protein synaptotagmin VII mediates cell invasion by Trypanosoma cruzi.
10734137 2000 SYNCRIP, a cytoplasmic counterpart of heterogeneous nuclear ribonucleoprotein R, interacts with ubiquitous synaptotagmin isoforms.
10613842 1999 Prediction of gene function by genome-scale expression analysis: prostate cancer-associated genes.
10556508 1999 Alternative splicing of synaptotagmins involving transmembrane exon skipping.
9615227 1998 Transcript mapping of the human chromosome 11q12-q13.1 gene-rich region identifies several newly described conserved genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.