Property Summary

NCBI Gene PubMed Count 19
PubMed Score 44.01
PubTator Score 12.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.400 1.3e-03
posterior fossa group A ependymoma -4.700 6.6e-20
oligodendroglioma -2.200 1.1e-10
glioblastoma -3.900 1.2e-04
atypical teratoid / rhabdoid tumor -3.900 1.4e-04
primitive neuroectodermal tumor -2.200 3.5e-02
adult high grade glioma -4.100 1.8e-06
pilocytic astrocytoma -5.400 1.5e-15
subependymal giant cell astrocytoma -4.466 3.8e-02
lung carcinoma 4.900 1.0e-53
Pick disease -1.800 1.6e-02
ovarian cancer -4.400 1.2e-16

Gene RIF (4)

PMID Text
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
22082156 Knockdown of synaptotagmin IV (SYT4) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21315262 Synaptotagmin 4 negatively regulates oxytocin exocytosis, and dietary obesity is associated with increased synaptotagmin 4 binding to vesicles.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSK      1 - 70
KKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLK     71 - 140
SSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRV    141 - 210
LRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKR    211 - 280
NVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTP    281 - 350
NAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH    351 - 420
VLCDG                                                                     421 - 425
//

Text Mined References (21)

PMID Year Title
26750488 2016 Upregulation and axonal transport of synaptotagmin-IV in the direct-pathway medium spiny neurons in hemi-parkinsonian rats induced by dopamine D1 receptor stimulation.
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
25416956 2014 A proteome-scale map of the human interactome network.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
21738487 2011 Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease.
21315262 2011 Neuropeptide exocytosis involving synaptotagmin-4 and oxytocin in hypothalamic programming of body weight and energy balance.
21153436 2011 Synaptotagmin IV acts as a multi-functional regulator of Ca2+-dependent exocytosis.
20735850 2010 Upregulation of synaptotagmin IV inhibits transmitter release in PC12 cells with targeted synaptotagmin I knockdown.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10938284 2000 The human synaptotagmin IV gene defines an evolutionary break point between syntenic mouse and human chromosome regions but retains ligand inducibility and tissue specificity.
10734137 2000 SYNCRIP, a cytoplasmic counterpart of heterogeneous nuclear ribonucleoprotein R, interacts with ubiquitous synaptotagmin isoforms.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10397765 1999 Functional and biochemical analysis of the C2 domains of synaptotagmin IV.
8901523 1996 Mirror image motifs mediate the interaction of the COOH terminus of multiple synaptotagmins with the neurexins and calmodulin.
8058779 1994 A third synaptotagmin gene, Syt3, in the mouse.
7993622 1994 Functional properties of multiple synaptotagmins in brain.