Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.16
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.800 2.3e-03
ependymoma -2.200 1.0e-05
glioblastoma -3.000 6.6e-04
oligodendroglioma -2.100 4.3e-12
sonic hedgehog group medulloblastoma -3.600 8.7e-05
atypical teratoid / rhabdoid tumor -3.600 8.3e-05
medulloblastoma, large-cell -4.400 7.9e-04
adult high grade glioma -2.400 6.8e-03
pilocytic astrocytoma -1.800 3.9e-03
pituitary cancer -1.500 3.8e-04
psoriasis -1.200 4.9e-06

Synonym

Accession Q17RD7 B4DZH2 B7ZL60 C9J8I3 Q707N2 Q7Z441 Q8IUU0 Q9BQR8
Symbols yt14r
SYT14L
syt14r
Strep14
CHR14SYT

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16946482 Human synaptotagmin tandem C2 domains C2A-C2B have been expressed as a glutathione-S-transferase fusion protein in Escherichia coli, purified, and crystallized and the preliminary X-ray analysis reported.

AA Sequence

MVLAMASQDVQNFFQPFSSWISRVYEALQQAGDMLSASLVNISKQDSKLSDKLDQDLDNIQIQETYFEDE      1 - 70
EQDNDWSQEDANSLFLEVDHFSCCNSDLQDSAQNSSPSLSQHAKDSCSTMSQWPNWASDDRKLPHVLSSI     71 - 140
AEEEHHLEKQRSGLQHGFDSQLPGTLETVNGKKQVNSFGDDEELSTSSDSDEEVIKQFEISVSRSQSFRS    141 - 210
VTSEKGKQTGLEQKPKFSRSLLTHGEDGTEVSACEDLDGASQRRYSENLSYGEDDHIPAHSQSPCERGDA    211 - 280
KHHGTSHQESSVVQSLRRQSTEGSLEMETAFNSRGFEDSYATDSSSMWSPEEQDRTNLQVPSGVSEPISK    281 - 350
CGDLDVIFEYRAASQKLTVTIVRAQGLPDKDRSGVNSWQVHVVLLPGKKHRGRTNIQRGPNPVFREKVTF    351 - 420
AKLEPRDVAACAVRFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVS    421 - 490
HSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRC    491 - 560
KTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKE    561 - 630
TKGQQICRWHTLLES                                                           631 - 645
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
24478790 2013 Genome wide association and linkage analyses identified three loci-4q25, 17q23.2, and 10q11.21-associated with variation in leukocyte telomere length: the Long Life Family Study.
20707712 2010 A genome-wide association study of self-rated health.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16946482 2006 Purification, crystallization and X-ray diffraction analysis of human synaptotagmin 1 C2A-C2B.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15238157 2004 Synaptotagmin gene content of the sequenced genomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12801916 2003 Molecular cloning, expression, and characterization of a novel class of synaptotagmin (Syt XIV) conserved from Drosophila to humans.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543631 2001 Genomic analysis of synaptotagmin genes.