Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.86
PubTator Score 6.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -3.900 4.1e-03
posterior fossa group A ependymoma -5.400 1.3e-20
oligodendroglioma -2.900 2.6e-16
glioblastoma -4.400 1.1e-05
osteosarcoma 1.953 2.8e-02
sonic hedgehog group medulloblastoma -3.800 1.1e-06
atypical teratoid / rhabdoid tumor -4.500 2.5e-07
medulloblastoma, large-cell -3.600 1.2e-05
pancreatic ductal adenocarcinoma liver m... 2.016 4.9e-02
non-small cell lung cancer 1.049 2.2e-05
intraductal papillary-mucinous carcinoma... 2.700 6.9e-03
intraductal papillary-mucinous neoplasm ... 2.500 2.1e-02
lung cancer 2.500 4.3e-05
breast carcinoma 1.500 7.0e-03
adult high grade glioma -4.200 9.3e-08
pilocytic astrocytoma -5.900 3.1e-17
lung carcinoma 5.300 7.7e-74
Pick disease -1.900 2.2e-02
Breast cancer 2.200 1.5e-03
ovarian cancer 2.000 6.7e-05
pituitary cancer -3.800 4.8e-07
pancreatic cancer 1.800 2.1e-02

Gene RIF (4)

PMID Text
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of synaptotagmin XIII (SYT13) in U-937 macrophages
20840848 These studies combine to suggest that SYT13 is a liver tumor suppressor gene and that its function may be mediated through pathways implicated in mesenchymal to epithelial transition
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18202767 human SYT13 functions as a liver tumor suppressor gene that complements a molecular defect in rat liver tumor cells resulting in a normalized cellular phenotype in vitro and suppression of tumorigenicity in vivo

AA Sequence

MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEP      1 - 70
VQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVE     71 - 140
DVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQT    141 - 210
ALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTS    211 - 280
AKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKH    281 - 350
KINPVWNEMIMFELPDDLLQASSVELEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAM    351 - 420
WHQLHL                                                                    421 - 426
//

Text Mined References (17)

PMID Year Title
20840848 2010 Exogenous expression of synaptotagmin XIII suppresses the neoplastic phenotype of a rat liver tumor cell line through molecular pathways related to mesenchymal to epithelial transition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18202767 2008 Re-expression of tumorigenicity after attenuation of human synaptotagmin 13 in a suppressed microcell hybrid cell line.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543631 2001 Genomic analysis of synaptotagmin genes.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11171101 2001 Characterization of KIAA1427 protein as an atypical synaptotagmin (Syt XIII).
11076863 2000 DNA cloning using in vitro site-specific recombination.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.