Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.51
PubTator Score 10.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 2.2e-04
Common variable immunodeficiency 1.554 7.6e-04
cutaneous lupus erythematosus 1.900 3.8e-03
gastric cancer 1.100 1.1e-03
glioblastoma 1.500 1.2e-02
group 3 medulloblastoma -1.100 2.4e-04
interstitial cystitis 1.600 1.2e-03
intraductal papillary-mucinous adenoma (... -1.100 2.9e-02
intraductal papillary-mucinous carcinoma... -1.200 4.2e-03
lung cancer 2.500 4.7e-04
lung carcinoma 2.200 1.6e-29
malignant mesothelioma -2.800 2.1e-08
medulloblastoma, large-cell -2.800 6.1e-05
nephrosclerosis 1.143 2.2e-03
oligodendroglioma 1.200 3.8e-02
osteosarcoma -1.238 4.5e-02
ovarian cancer 1.400 2.4e-04
psoriasis -1.300 3.2e-02
subependymal giant cell astrocytoma -1.696 2.3e-02

Gene RIF (6)

AA Sequence

MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLS      1 - 70
NKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLT     71 - 140
PGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRV    141 - 210
KTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRD    211 - 280
IIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHV    281 - 350
KKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRK    351 - 420
PVAKWHSLSEY                                                               421 - 431
//

Text Mined References (24)

PMID Year Title