Property Summary

NCBI Gene PubMed Count 21
PubMed Score 10.78
PubTator Score 10.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
nephrosclerosis 1.143 2.2e-03
gastric cancer 1.100 1.1e-03
malignant mesothelioma -2.800 2.1e-08
oligodendroglioma 1.200 3.8e-02
cutaneous lupus erythematosus 1.900 3.8e-03
psoriasis -1.300 3.2e-02
osteosarcoma -1.238 4.5e-02
group 4 medulloblastoma -1.600 6.2e-09
glioblastoma 1.500 1.2e-02
atypical teratoid / rhabdoid tumor -1.500 2.2e-04
medulloblastoma, large-cell -2.800 6.1e-05
Common variable immunodeficiency 1.554 7.6e-04
intraductal papillary-mucinous adenoma (... -1.100 2.9e-02
intraductal papillary-mucinous carcinoma... -1.400 1.4e-02
lung cancer 2.500 4.7e-04
interstitial cystitis 2.100 3.0e-05
subependymal giant cell astrocytoma -1.696 2.3e-02
lung carcinoma 2.200 1.6e-29
ovarian cancer 1.400 2.4e-04

Gene RIF (5)

PMID Text
24164654 The genetic variations of VAMP2, Synaptotagmin XI might be indication of the relationship between these genes and idiopathic generalized epilepsy
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17192956 Excessive expression of Syt11 can be associated with schizophrenia.
15354386 Lack of disease-causing mutations in a detailed analysis of a large sample of familial and sporadic Parkinson's disease patients argues against a major role of mutations in the synaptotagmin XI gene in PD.
12925569 parkin interacts with and ubiquitinates synaptotagmin XI

AA Sequence

MAEITNIRPSFDVSPVVAGLIGASVLVVCVSVTVFVWSCCHQQAEKKQKNPPYKFIHMLKGISIYPETLS      1 - 70
NKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLT     71 - 140
PGESKTTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRV    141 - 210
KTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRD    211 - 280
IIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHV    281 - 350
KKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRK    351 - 420
PVAKWHSLSEY                                                               421 - 431
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24164654 2014 Genetic variants of synaptic vesicle and presynaptic plasma membrane proteins in idiopathic generalized epilepsy.
22645275 2012 Identification of novel ATP13A2 interactors and their role in ?-synuclein misfolding and toxicity.
21563316 2012 Synaptic vesicle trafficking and Parkinson's disease.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19060904 2009 An empirical framework for binary interactome mapping.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17192956 2007 Synaptotagmin XI as a candidate gene for susceptibility to schizophrenia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15354386 2004 Screening for mutations in synaptotagmin XI in Parkinson's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12925569 2003 The autosomal recessive juvenile Parkinson disease gene product, parkin, interacts with and ubiquitinates synaptotagmin XI.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543631 2001 Genomic analysis of synaptotagmin genes.
10734137 2000 SYNCRIP, a cytoplasmic counterpart of heterogeneous nuclear ribonucleoprotein R, interacts with ubiquitous synaptotagmin isoforms.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.