Property Summary

NCBI Gene PubMed Count 4
PubMed Score 6.37
PubTator Score 4.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 2.5e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 0.7
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 3.182 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 2.5e-07

Gene RIF (1)

AA Sequence

MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDISVSLLAVVVSFCGLALLV      1 - 70
VSLFVFWKLCWPCWKSKPVTSNITTLPQSISSAPTEVFETEEKKEIKENEKPAVKAIEPAIKISHTSPDI     71 - 140
PAEVQTALKEHLIKHARVQRQITEPTSSTRHSSFRRHLPRQMQVSSVDFSMGTEPVLQRGETTTSIGRIK    141 - 210
PELYKQKSVDSEGNQNEDVKICGKLNFTLQYDYENELLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRK    211 - 280
KKFQTRVHRKTLNPLFDETFQFPVAYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDLSREATV    281 - 350
WKDIHCATTESIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTT    351 - 420
TKKNTLNPVYNEAIIFDIPPENVDQVSLSIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDHWNEMLAYHRK    421 - 490
PITHWHPLLELPGRATSFDSQGSCPSPKPPSTP                                         491 - 523
//

Text Mined References (4)

PMID Year Title