Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.8e-03
medulloblastoma, large-cell -1.500 1.1e-05
osteosarcoma -1.263 5.0e-06

AA Sequence

MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSF      1 - 70
ILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMR     71 - 140
TELKEIPLNSAPKSNV                                                          141 - 156
//

Text Mined References (8)

PMID Year Title