Property Summary

NCBI Gene PubMed Count 17
PubMed Score 16.94
PubTator Score 9.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -1.300 4.3e-02
osteosarcoma 1.566 2.2e-04
ependymoma 1.900 2.5e-10
glioblastoma 1.900 2.0e-02
hereditary spastic paraplegia -1.076 4.4e-03
pediatric high grade glioma 1.400 4.4e-04
group 4 medulloblastoma -1.100 1.7e-03
progressive supranuclear palsy -1.200 8.5e-03
ovarian cancer -1.200 4.6e-04
Down syndrome 1.800 3.2e-04
dermatomyositis -1.500 2.1e-03

 GO Function (1)

Gene RIF (1)

PMID Text
18720419 A role is found for synaptophysin I in the enduring neuroplasticity in the prefrontal cortical glutamate circuitry that is associated with ethanol dependence.

AA Sequence

MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEIQVNCPPAVTE      1 - 70
NKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYT     71 - 140
SLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKIATGHNIIDELPPCKKKAVLCYFGSVTSMGS    141 - 210
LNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSAPHSQGGIPPPTGI                         211 - 259
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18720419 2008 Elevated synaptophysin I in the prefrontal cortex of human chronic alcoholics.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10636906 2000 Pantophysin is a phosphoprotein component of adipocyte transport vesicles and associates with GLUT4-containing vesicles.
10370136 1999 Tissue expression of the vesicle protein pantophysin.
9847074 1998 Toward a complete human genome sequence.
8707851 1996 Pantophysin is a ubiquitously expressed synaptophysin homologue and defines constitutive transport vesicles.
8034131 1994 Expression of the synaptophysin gene family is not restricted to neuronal and neuroendocrine differentiation in rat and human.
1730063 1992 Molecular cloning of a cDNA encoding a novel protein related to the neuronal vesicle protein synaptophysin.