Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.27
PubTator Score 4.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.700 2.4e-03
posterior fossa group A ependymoma -6.500 4.1e-20
oligodendroglioma -3.700 7.1e-03
glioblastoma -5.500 2.7e-06
sonic hedgehog group medulloblastoma -5.300 2.0e-10
atypical teratoid / rhabdoid tumor -3.600 2.1e-04
medulloblastoma, large-cell -3.800 4.4e-05
primitive neuroectodermal tumor -3.800 6.9e-03
pediatric high grade glioma -5.100 3.7e-09
pilocytic astrocytoma -6.500 2.2e-14
Pick disease -2.000 1.6e-02
psoriasis 1.400 2.6e-06

 GO Function (1)

Gene RIF (4)

PMID Text
25138779 Results from genome-wide association studies identify synaptoporin gene as one of the three susceptibility loci candidate for congenital left-sided lesions.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12974474 cloning and characterization of the human cDNA that encodes the human homologue of synaptoporin
12740598 Tyrosine nitration of synaptophysin is related to Amyloid beta induced impairment of acetylcholine release.

AA Sequence

MCMVIFAPLFAIFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLA      1 - 70
LIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLS     71 - 140
DVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRY    141 - 210
LSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI                   211 - 265
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25138779 2015 Genome-wide association study of maternal and inherited effects on left-sided cardiac malformations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12974474 2003 Cloning and sequence analysis of the human cDNA encoding the synaptoporin (delta), a highly conservative synaptic vesicle protein.
12740598 2003 Tyrosine nitration of a synaptic protein synaptophysin contributes to amyloid beta-peptide-induced cholinergic dysfunction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12271488 2002 Synaptic vesicle protein synaptoporin is differently expressed by subpopulations of mouse hippocampal neurons.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8034131 1994 Expression of the synaptophysin gene family is not restricted to neuronal and neuroendocrine differentiation in rat and human.