Property Summary

NCBI Gene PubMed Count 27
PubMed Score 94.86
PubTator Score 3151.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 3.000 1.4e-08
psoriasis -1.900 2.1e-06
medulloblastoma -2.500 7.1e-05
astrocytoma 1.900 3.4e-02
medulloblastoma, large-cell -2.800 5.0e-07
primitive neuroectodermal tumor -1.500 7.9e-03
non-small cell lung cancer -1.480 3.7e-14
intraductal papillary-mucinous adenoma (... -1.800 1.3e-04
intraductal papillary-mucinous carcinoma... -1.300 7.6e-03
colon cancer -6.100 3.6e-06
lung cancer -3.500 2.0e-06
posterior fossa group B ependymoma 1.200 1.4e-06
subependymal giant cell astrocytoma 1.883 3.3e-03
lung adenocarcinoma -1.500 1.5e-08
Breast cancer -5.000 6.6e-23
breast carcinoma -2.800 5.8e-37
ductal carcinoma in situ -1.700 1.5e-02
invasive ductal carcinoma -3.400 3.1e-03
ovarian cancer 1.400 4.1e-05

Gene RIF (20)

PMID Text
25447537 alpha-Synemin localizes to the M-band of the sarcomere through interaction with the M10 region of titin
23594359 Immunohistochemistry of synemin in reactive astrocytes and Rosenthal fibers in two patients with Alexander disease. There was an abundance of GFAP-positive Rosenthal fibers and widespread reactive gliosis in the white matter and subpial regions.
22337773 synemin positively regulates glioblastoma cell proliferation by helping sequester PP2A away from Akt, thereby favoring Akt activation.
21144834 Synemin knock-down did not influence the cytoskeleton expression and organization of human Chang liver cells
20573469 Desmuslin expression is required for the maintenance of vascular smooth muscle phenotype. Decreased desmuslin expression may affect differentiation of VSMCs and ultimately contribute to the development of varicose veins.
20543860 SYNM could represent a novel putative breast tumor suppressor gene that is prone to epigenetic silencing. SYNM promoter methylation may become a useful predictive biomarker to stratify breast cancer patients' risk for tumor relapse.
20199207 The differences in human syncoilin and beta-synemin mRNA ratios between Duchenne muscular dystrophy and normal muscles were not statistically significant
19853601 The LIM domain protein zyxin was identified as an interaction partner for human synemin.
18342854 Results suggest human alpha-synemin plays an essential role in linking the heteropolymeric intermediate filament to adherens-type junctions, such as the costameres within mammalian striated muscle cells, via its interaction with talin.
18084875 results revealed that synemin was modulated nearly in all human human hepatocellular carcinoma cases
18028034 alpha-synemin, but not beta-synemin, interacts with both vinculin and metavinculin
17564317 The stability of DMN was analyzed under the action of low-level laser therapy.
16777071 Mammalian synemin is also shown to colocalize with dystrophin within muscle cell cultures
16476617 Desmuslin is down-regulated in incompetent saphenous veins.
15657940 synemin is associated with ruffled membranes in addition to being distributed along the intermediate filament network
15318345 Based on its localization and its expression pattern, beta-synemin functions as a structural protein involved in maintaining muscle integrity through its interactions with alpha-dystrobrevin, desmin, and other structural proteins.
14552890 The colocalization of Synemin [syn] with vimentin, GFAP, or neurofilament supports the idea that Syn is a key cross-linking protein in morphogenesis that connects different cytoskeletal structures
12887813 the default of KIAA0353 gene may play a role in the occurrence and development of varicose great saphenous vein in PDVI patients.
12669240 Expression of the intermediate filament protein synemin in myofibrillar myopathies and other muscle diseases.
11454237 Genomic organization and single-nucleotide polymorphism map of desmuslin, a novel intermediate filament protein on chromosome 15q26.3.

AA Sequence

MLSWRLQTGPEKAELQELNARLYDYVCRVRELERENLLLEEELRGRRGREGLWAEGQARCAEEARSLRQQ      1 - 70
LDELSWATALAEGERDALRRELRELQRLDAEERAARGRLDAELGAQQRELQEALGARAALEALLGRLQAE     71 - 140
RRGLDAAHERDVRELRARAASLTMHFRARATGPAAPPPRLREVHDSYALLVAESWRETVQLYEDEVRELE    141 - 210
EALRRGQESRLQAEEETRLCAQEAEALRREALGLEQLRARLEDALLRMREEYGIQAEERQRAIDCLEDEK    211 - 280
ATLTLAMADWLRDYQDLLQVKTGLSLEVATYRALLEGESNPEIVIWAEHVENMPSEFRNKSYHYTDSLLQ    281 - 350
RENERNLFSRQKAPLASFNHSSALYSNLSGHRGSQTGTSIGGDARRGFLGSGYSSSATTQQENSYGKAVS    351 - 420
SQTNVRTFSPTYGLLRNTEAQVKTFPDRPKAGDTREVPVYIGEDSTIARESYRDRRDKVAAGASESTRSN    421 - 490
ERTVILGKKTEVKATREQERNRPETIRTKPEEKMFDSKEKASEERNLRWEELTKLDKEARQRESQQMKEK    491 - 560
AKEKDSPKEKSVREREVPISLEVSQDRRAEVSPKGLQTPVKDAGGGTGREAEARELRFRLGTSDATGSLQ    561 - 630
GDSMTETVAENIVTSILKQFTQSPETEASADSFPDTKVTYVDRKELPGERKTKTEIVVESKLTEDVDVSD    631 - 700
EAGLDYLLSKDIKEVGLKGKSAEQMIGDIINLGLKGREGRAKVVNVEIVEEPVSYVSGEKPEEFSVPFKV    701 - 770
EEVEDVSPGPWGLVKEEEGYGESDVTFSVNQHRRTKQPQENTTHVEEVTEAGDSEGEQSYFVSTPDEHPG    771 - 840
GHDRDDGSVYGQIHIEEESTIRYSWQDEIVQGTRRRTQKDGAVGEKVVKPLDVPAPSLEGDLGSTHWKEQ    841 - 910
ARSGEFHAEPTVIEKEIKIPHEFHTSMKGISSKEPRQQLVEVIGQLEETLPERMREELSALTREGQGGPG    911 - 980
SVSVDVKKVQGAGGSSVTLVAEVNVSQTVDADRLDLEELSKDEASEMEKAVESVVRESLSRQRSPAPGSP    981 - 1050
DEEGGAEAPAAGIRFRRWATRELYIPSGESEVAGGASHSSGQRTPQGPVSATVEVSSPTGFAQSQVLEDV   1051 - 1120
SQAARHIKLGPSEVWRTERMSYEGPTAEVVEVSAGGDLSQAASPTGASRSVRHVTLGPGQSPLSREVIFL   1121 - 1190
GPAPACPEAWGSPEPGPAESSADMDGSGRHSTFGCRQFHAEKEIIFQGPISAAGKVGDYFATEESVGTQT   1191 - 1260
SVRQLQLGPKEGFSGQIQFTAPLSDKVELGVIGDSVHMEGLPGSSTSIRHISIGPQRHQTTQQIVYHGLV   1261 - 1330
PQLGESGDSESTVHGEGSADVHQATHSHTSGRQTVMTEKSTFQSVVSESPQEDSAGDTSGAEMTSGVSRS   1331 - 1400
FRHIRLGPTETETSEHIAIRGPVSRTFVLAGSADSPELGKLADSSRTLRHIAPGPKETSFTFQMDVSNVE   1401 - 1470
AIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRS   1471 - 1540
VISDEKKVALLYLDNEEEENDGHWF                                                1541 - 1565
//

Text Mined References (33)

PMID Year Title
25447537 2014 ?-Synemin localizes to the M-band of the sarcomere through interaction with the M10 region of titin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23594359 2014 Synemin is expressed in reactive astrocytes and Rosenthal fibers in Alexander disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22337773 2012 Synemin promotes AKT-dependent glioblastoma cell proliferation by antagonizing PP2A.
21144834 2011 Synemin down-regulation in human hepatocellular carcinoma does not destabilize cytoskeletons in vivo.
20573469 2010 Desmuslin gene knockdown causes altered expression of phenotype markers and differentiation of saphenous vein smooth muscle cells.
20543860 2010 Intermediate filament dynamics and breast cancer: aberrant promoter methylation of the Synemin gene is associated with early tumor relapse.
20199207 2010 Dysbindin, syncoilin, and beta-synemin mRNA levels in dystrophic muscles.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19853601 2010 Synemin interacts with the LIM domain protein zyxin and is essential for cell adhesion and migration.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18342854 2008 Identification of a repeated domain within mammalian alpha-synemin that interacts directly with talin.
18084875 2004 Altered synemin could affect the organization of intermediate filament in human hepatocellular carcinoma.
18028034 2008 Human alpha-synemin interacts directly with vinculin and metavinculin.
17564317 2004 Effects of diode 808 nm GaAlAs low-power laser irradiation on inhibition of the proliferation of human hepatoma cells in vitro and their possible mechanism.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16777071 2006 Interactions of intermediate filament protein synemin with dystrophin and utrophin.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16476617 2006 Downregulation of desmuslin in primary vein incompetence.
15657940 2005 Intermediate filament protein synemin is present in human reactive and malignant astrocytes and associates with ruffled membranes in astrocytoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15318345 2004 Beta-synemin localizes to regions of high stress in human skeletal myofibers.
14552890 2003 Synemin expression in developing normal and pathological human retina and lens.
12887813 2003 [Default of KIAA0353 gene in varicose great saphenous vein accompanying primary deep vein valve insufficiency].
12669240 2003 Expression of the intermediate filament protein synemin in myofibrillar myopathies and other muscle diseases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11737198 2001 Human synemin gene generates splice variants encoding two distinct intermediate filament proteins.
11683385 2001 Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18.
11454237 2001 Genomic organization and single-nucleotide polymorphism map of desmuslin, a novel intermediate filament protein on chromosome 15q26.3.
11353857 2001 Desmuslin, an intermediate filament protein that interacts with alpha -dystrobrevin and desmin.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.